KEGG   Enterobacter lignolyticus G5: AO703_06955Help
Entry
AO703_06955       CDS       T04198                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kle  Enterobacter lignolyticus G5
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AO703_06955 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    AO703_06955 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AO703_06955 (gpmA)
Enzymes [BR:kle01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AO703_06955 (gpmA)
Membrane trafficking [BR:kle04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AO703_06955 (gpmA)
Exosome [BR:kle04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AO703_06955 (gpmA)
  Exosomal proteins of melanoma cells
   AO703_06955 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1495814..1496566)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgccacggcgaaagccagtggaacaacgaaaac
cgtttcaccggttggtacgacgttgatctgtcagagaaaggcgttagcgaagcgaaagcg
gcgggcaaactgctgaaagacgaaggcttcagcttcgattttgcttatacctctgtgctg
aaacgtgccatccacacgctgtggaacgtactggatgaactggaccaggcctggctgccg
gtggagaaatcctggaaactgaacgagcgccactacggcgcgctgcagggtctgaacaaa
gcggaaaccgcagaaaaatatggcgatgagcaggtgaaacagtggcgtcgcggcttcgcg
gtaaccccgccggagctgacgaaagacgacgaacgctacccgggacacgacccgcgctat
gcgaaactgaccgacgcagagctgccaaccaccgaaagcctggcgctgaccatcgatcgc
gttgtgccgtactggaacgaaaccattctgccgcgcctgaaaagcggcgagcgcgtgatc
atcgccgcgcacggcaactccctgcgcgcgctggtgaaatacctggacaacatgggtgaa
gacgagatcctcgaactgaatattccgaccggcgtgccgctggtttatgagttcgacgag
aacttcaaaccgcttaaacgctattacctgggcaacgccgacgaaatcgccgcaaaagct
gccgccgtcgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system