KEGG   Klebsiella michiganensis RC10: VW41_20640Help
Entry
VW41_20640        CDS       T03782                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
kmi  Klebsiella michiganensis RC10
Brite
Enzymes [BR:kmi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VW41_20640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AJZ91253
UniProt: A0A0D5WZA2
LinkDB All DBs
Position
4459703..4460230
Genome map
AA seq 175 aa AA seqDB search
MNKLKTLKLALGITALTCTGLAQAATVAMNTVDANGTSTPAGTIEYHATQYGVVFTPNLK
GLPPGIHGFHVHTNPNCGPGMQDGKMVAGLAAGGHLDPAHTGKHEGPWGNGHLGDLPALY
VDSDGTATYPVLAPRLRMSDLKGHSLMIHAGGDNHSDHPAMLGGGGARMVCGVTS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttaaaaacactaaaactggcgctgggtattaccgccctcacctgcaccgga
ctggcacaggccgccacggtcgccatgaacaccgtggacgccaacggcacttccaccccg
gcgggcaccattgagtaccacgccacccagtacggcgtggtctttacgccgaacctgaaa
ggcctgccgccgggtatccacggcttccacgttcacactaatccgaactgcggccccggc
atgcaggacggcaaaatggtggctggcctggcggcgggcggccacttagatccggcccac
accggcaagcatgaaggcccgtggggtaacggccacctcggcgacctgcctgcgctgtac
gtcgacagcgacggcaccgcaacctatccggtgctggctcctcgcctgcgcatgtctgac
ctcaaaggccactcgctgatgatccacgccggcggcgacaaccactctgaccacccggca
atgctcggcggcggcggggcgcgtatggtgtgcggagtcacgtcatga

DBGET integrated database retrieval system