KEGG   Komagataeibacter nataicola: B0W47_07005Help
Entry
B0W47_07005       CDS       T04737                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
kna  Komagataeibacter nataicola
Brite
Enzymes [BR:kna01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B0W47_07005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AQU88936
UniProt: A0A1U9RPX0
LinkDB All DBs
Position
1452814..1453356
Genome map
AA seq 180 aa AA seqDB search
MFMPIRRLRLLGLLSLACGFAAFASPVRAADTASGELTGADGAAHGSIHVTAAPKGVLLR
IEAHGLIPGWHGVHFHEKGTCGVPKFTSAGAHVHATTPVVHGLLNANANDAGDLPNIFVG
QDGSVTVELYSTLVTLNGTDGRPGLMDPDGSSLVIHANPDDYRSQPIGGAGDRVACAVIQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
attttcatgcccatacgacgtctccggcttcttggcctgctgtccctcgcctgcggtttc
gcggcgttcgcctccccggtccgggcggcggacacggcctcgggcgaactgacgggcgcg
gatggcgcggcgcacgggtcgatccatgtcacggcggcgccgaagggagtactgctccgc
atcgaggcccatggcctgatcccgggctggcatggcgtgcatttccatgaaaaaggcacg
tgtggcgtaccgaaattcaccagcgcgggcgcgcatgtccatgccacgacgccggtggtc
catgggctgctgaacgcgaacgccaacgatgcgggagacctgcccaacatcttcgtcggg
caggatggcagcgtgacggtggagctttattccacgctggtcacgctcaacggcacggac
gggcggccggggctgatggaccctgatggatcgtcgctggtcatccacgccaaccccgat
gattatcgcagccagcccattggcggcgcgggggaccgcgtggcctgcgcggtaatccag
taa

DBGET integrated database retrieval system