KEGG   Klebsiella oxytoca KONIH1: KONIH1_16170Help
Entry
KONIH1_16170      CDS       T03269                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
kok  Klebsiella oxytoca KONIH1
Brite
Enzymes [BR:kok01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KONIH1_16170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3399519..3400100
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQAYVTNLNNLIKGTPFEGKTLEEIVRSS
DGGVFNNAAQVWNHTFYWNCLAPNAGGEPQGELAAAIAKSFGSFADFKAKFTDAAVKNFG
AGWTWLVKNADGSLAIVSTSNAGTPLTSDATPLLTVDVWEHAYYIDYRNARPNYLEHFWA
LVNWKFVAANLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgaattacctgcattaccatatgcaaaagacgccctggcgccgcacatttcc
gcagaaaccctggaataccactacggtaaacaccaccaggcctacgtcaccaacctgaat
aacctgatcaaaggcaccccgtttgaaggcaaaaccctggaagagatcgtgcgttcttcc
gatggcggcgtttttaacaacgccgctcaggtctggaaccacaccttctactggaactgc
ctcgcgccgaacgccggcggcgaaccgcaaggcgaactggcggcggctatcgctaagtcc
ttcggcagcttcgctgatttcaaagccaaattcaccgacgcagcggtaaaaaacttcggc
gcaggctggacctggctggtgaaaaacgccgacggtagcctggctattgtctccaccagc
aacgccggtacgccgctgaccagcgacgcgactccgctgctgaccgtggatgtctgggaa
cacgcttattacatcgactaccgtaacgcccgtccgaactatctggagcacttctgggcg
ctggtaaactggaagtttgttgctgctaatctggctgcataa

DBGET integrated database retrieval system