KEGG   Klebsiella oxytoca M1: HR38_05905Help
Entry
HR38_05905        CDS       T03349                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kom  Klebsiella oxytoca M1
Pathway
kom00620  Pyruvate metabolism
kom00680  Methane metabolism
kom01100  Metabolic pathways
kom01120  Microbial metabolism in diverse environments
kom01200  Carbon metabolism
Module
kom_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kom00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HR38_05905
  Energy metabolism
   00680 Methane metabolism
    HR38_05905
Enzymes [BR:kom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HR38_05905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIE68009
UniProt: A0A249WH39
LinkDB All DBs
Position
complement(1224464..1227115)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKEQPNLNET
IIKQAVESLSLELVLTAHPTEITRRTLIHKMGEINSCLKQLDNNDIADYERHQVMRRLRQ
LIAQSWHTDEIRKHRPTPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEDNLNYRLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQLLISELSMVECTDELR
ELAGAEGAQEPYRYLMKKLRTQLMETQAWLEARLKGQKLPKPAGLITQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKAFGVPLVRIDIRQESTRHTEALGEMTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLETCKVISEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAQWRDIMAEL
SDVSCEMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEGGKQSELESMCRDWPFFSTRLGMLEMVYSKADLWLAE
YYDQRLVKPELWKLGEELRELLSADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRLAEEKGEKPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgctttgcgtagtaatgtcagtatgctcggtaaggtgctgggc
gacaccatcaaggatgcgctgggagaaaacattcttgatcgtgtcgaaactatccgtaag
ttgtccaaatcttctcgcgctggcaatgaagccaaccgccaggagctgctcaccacgctg
caaaacttgtccaacgacgagctgctgccggtggcgcgcgccttcagccagtttctgaac
ctggcgaataccgctgagcaataccacagcatttcgccaaaaggcgaagcggccagtaat
ccggaagtgattgcccgcaccctgagaaagctcaaagagcaacccaatctcaacgaaacg
attattaaacaagccgttgaatccctgtcgctggagctggtgctgaccgcgcacccgacc
gaaatcacgcgtcgtacgctgatccacaagatgggcgagatcaacagctgcctgaagcag
ctcgataacaacgacattgcggactatgaacgtcatcaggtcatgcgccgtctgcgccag
ctgattgcccagtcgtggcacaccgatgaaatccgcaagcatcgccctaccccggtggat
gaagccaaatggggcttcgcggttgtcgaaaatagcctgtgggaaggcgtaccgaactac
ctgcgcgagctgaatgaacagctggaagataacctgaactatcggctgccggtcgatttt
gttccggttcgctttacgtcctggatgggcggcgaccgcgacggcaacccgaacgtgacc
gccgacattacccgccacgtcctgctgctcagccgctggaaggcaaccgatctgttcctg
aaagatgtccagctgctgatttccgagctgtcgatggttgagtgcaccgacgagctgcgt
gagctggcaggcgcggaaggcgctcaggaaccctatcgttacctgatgaaaaaactgcgc
acgcagctgatggagacccaggcctggctggaagcgcgcctgaaaggacagaaactgccg
aaaccggcgggccttatcacgcaaaacgagcagctgtgggaaccgctttacgcctgttac
cagtcgctacaagcctgcggtatgggcattatcgccaacggcgagctgctcgatactctg
cgccgcgtaaaagcctttggcgtaccgctggtgcgtatcgatatccgtcaggaaagcacc
cgccacaccgaagcgctgggcgaaatgacccgctatctcggcatcggcgactatgaaagc
tggtcagaagccgataaacaggccttcctgatccgcgaactgaactccaagcgtcctctg
ctgccgcgccagtgggagccaagcgaagaaacgcgcgaagtgctcgagacgtgcaaagtc
atctccgaagcgccgcgcggctctattgcggcctacgtgatttcgatggccaaaacgccg
tcagacgtcctggccgtgcatctgctgttgaaagaagccggcatcggcttcgcgctgccg
gtcgccccgctgttcgaaacgctggacgacctgaataacgccgacgacgttatgacccag
ctgctgaatatcgactggtatcgcggctttatccagggcaagcagatggtcatgatcggc
tattccgactcggcgaaagatgcgggcgtgatggccgcctcctgggcgcagtatcaggcg
caggacgcgttaattaagacctgtgaaaaagccggcattgagctgacgctgttccacggt
cgcggcggttctatcggccgcggcggcgcgccggcgcacgcggccctgctctctcagcct
ccgggaagcctgaaaggcggcctgcgcgttaccgaacagggcgagatgatccgctttaaa
tacggcctgccggaagtcaccatcagcagcctgtcgctctacaccagcgcgattctggaa
gccaacctgctgccgccgccggagccaaaagcgcaatggcgcgacatcatggccgagctg
tccgacgtctcctgcgagatgtatcgcggctacgtgcgtgaaaataaagattttgttcct
tacttccgttccgcaacgccggagcaggagctgggcaaactgccgctgggctcgcgtccg
gcaaaacgccgcccgaccggcggcgtcgagtcgctgcgcgccattccgtggatcttcgcg
tggacgcaaaaccgcctgatgctgccagcctggctgggcgccggcgccgcgctgcaaaaa
gtcgttgaaggcggcaagcagagcgagctggaaagcatgtgccgcgactggccgttcttc
tctacccgcctcggcatgctggaaatggtctactcaaaagccgacctgtggctggcggaa
tattacgatcagcgtctggtgaaaccggaactgtggaagctgggcgaagagctgcgtgaa
ctgctgtccgccgatatcaacgtggtactggcaatcgccaacgactcccacctgatggcc
gacctgccgtggatcgcggagtccatccagctacgtaatatctataccgacccgctgaac
gtgctccaggccgagctgctccatcgttcacgtctggcggaagagaaaggtgaaaaaccg
gacccgcgcgttgagcaagcgctgatggtcaccatcgcaggcgttgcggcaggcatgcgt
aacaccggctag

DBGET integrated database retrieval system