KEGG   Klebsiella michiganensis HKOPL1: J415_01870Help
Entry
J415_01870        CDS       T03188                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
koy  Klebsiella michiganensis HKOPL1
Brite
Translation factors [BR:koy03012]
 Eukaryotic Type
  Elongation factors
   J415_01870
 Prokaryotic Type
   J415_01870
Mitochondrial biogenesis [BR:koy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    J415_01870
Exosome [BR:koy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   J415_01870
  Exosomal proteins of breast cancer cells
   J415_01870
  Exosomal proteins of colorectal cancer cells
   J415_01870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(409234..410418)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDADWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggttctgctcgcgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacttctcacgttgaatatgacaccccgactcgccactacgcgcacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgaaatggaagttcgtgaacttctgtctcag
tacgatttcccgggcgacgacactccgatcgttcgcggttccgctctgaaagcgctggaa
ggcgacgcagactgggaagcgaaaatcatcgaactggctggctacctggattcttacatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagttggc
gaagaagttgaaatcgttggtatcaaagagactgcgaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggttctatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtacaactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggt
ggccgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system