KEGG   Klebsiella pneumoniae blaNDM-1: FH42_22130Help
Entry
FH42_22130        CDS       T03440                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00250  Alanine, aspartate and glutamate metabolism
kpb00280  Valine, leucine and isoleucine degradation
kpb00410  beta-Alanine metabolism
kpb00640  Propanoate metabolism
kpb00650  Butanoate metabolism
kpb01100  Metabolic pathways
kpb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    FH42_22130
   00650 Butanoate metabolism
    FH42_22130
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FH42_22130
   00280 Valine, leucine and isoleucine degradation
    FH42_22130
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FH42_22130
Enzymes [BR:kpb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     FH42_22130
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     FH42_22130
Amino acid related enzymes [BR:kpb01007]
 Aminotransferase (transaminase)
  Class III
   FH42_22130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AIJ43326
UniProt: W9B438
LinkDB All DBs
Position
complement(4578020..4579303)
Genome map
AA seq 427 aa AA seqDB search
MNSNKAMMARRSDAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
QVVAAVEDQLKKLSHTCFQVLAYEPYLALCEKMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATGRSGAIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSD
DEAIASIHRIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLQIFEQENLLEKANQLGDTLRQGLLAIAEDHPEIGDVRGLGAMIAIELF
EEGDRSRPNARLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIEQGLKIIADC
FSEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagcaatgatggcgcgtcgcagcgacgcggtcccgcgcggcgtcggc
cagatccaccctatcttcgccgaacgcgcggagaactgccgggtgtgggacgtggaaggc
cgggaatatctcgattttgccggcggtatcgcggtgctcaataccggccacctgcatccg
caggttgtcgccgccgtcgaagaccagctgaaaaagctgtcgcatacctgcttccaggtg
ctggcctatgagccttatctggcgctgtgcgaaaagatgaatcaaaaggtgcccggtgat
ttcgccaagaaaaccctgctggtcaccaccgggtcggaagcggtggagaacgcggtgaag
atcgcccgcgcggcaaccgggcgcagcggcgctatcgccttcaccggcgcctatcacggc
cgcacccattacaccctgtcgctgaccggcaaagtgaatccttactccgccggtatgggc
ttaatgccgggccatgtctatcgcgccctctacccatgcgcgctgcacggcgtcagtgat
gacgaggcgatcgccagcatccatcgcatcttcaaaaacgatgccgcgccggaagatatc
gccgccatcattattgagccggtgcagggtgaaggcgggttctatgccgcctccccggcc
tttatgcagcgcctgcgcgccctgtgcgacgagcacggcattatgctcatcgccgatgag
gtccagagcggcgcgggccgcaccggtaccctgttcgccatggagcagatgggcgtcgcg
gcggatatcaccaccttcgccaaatccatcgccggcggtttcccgctggcgggcgtcacc
ggccgcgcggaggtgatggacgccatcgcccccggcggactgggcggcacctacgccggc
aaccccatcgcctgcgccgccgccctggcggtattacagattttcgagcaggagaatctg
ctggaaaaagccaaccagctcggcgacaccctgcgccagggcctgctggcgatcgctgaa
gatcatccggagatcggcgacgtgcgcggtctgggggcgatgatcgccattgagctgttt
gaagagggcgaccgcagcaggccgaacgccaggctgacggcggatatcgtcgcccgcgcc
cgcgacaaaggcctgatcctgctctcctgcgggccgtactacaacgtgctgcgcatcctg
gtgccgctgaccatcgaagaggcgcagatcgagcaggggctcaagatcatcgccgactgc
tttagcgaggcgaaacaggcatag

DBGET integrated database retrieval system