KEGG   Klebsiella pneumoniae 342: KPK_1455Help
Entry
KPK_1455          CDS       T00772                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
kpe  Klebsiella pneumoniae 342
Brite
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     KPK_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACI09729
UniProt: B5XNT8
LinkDB All DBs
Position
complement(1474441..1475070)
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAQLAYRLIRVDIGKGEQFHPQFLAISPNNKIPAIVDHMP
VDGGAPLSVFESGAILLYLAEKSGKLLSGELRERYITLQWLFWQVGGLGPMLGQNQHFAH
SAPQTVPYAIERFQVETQRLYGVLNHRLEASPWLGGDHYSIADIAAWPWVNSHVRQRIDL
ANYPAVHNWYERIKQRPATIEAMLKIQPY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctctactatgcacccaccccaaacggccacaaaatcaccctgtttctcgaa
gaggcgcagctggcctatcggctaattcgggtcgatatcggcaaaggggaacagtttcat
ccacagtttctggcgatttcgccgaataacaaaatcccggcgattgtcgaccatatgcct
gtcgatggcggagcgccgttgagcgtcttcgagtccggcgccatcctgctctatctggcg
gagaaaagcggcaagctgctgagcggtgagctgcgggagcgctatattactctgcaatgg
ctattctggcaggtcggcggtcttgggccgatgctgggacaaaatcagcattttgcccac
tcggcgccgcaaacggtgccctatgccattgaacgttttcaggtggaaacccagcgactg
tacggggttctcaaccaccgcctcgaagccagtccgtggcttggcggcgaccattacagc
atcgccgatattgccgcctggccctgggtcaacagccatgtccgacagcgtatcgatctg
gcgaactatccggcggtgcataactggtatgagcgcattaagcagcgaccggcgaccatt
gaagcgatgctaaaaattcagccttattaa

DBGET integrated database retrieval system