KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_00365Help
Entry
KPNIH32_00365     CDS       T03468                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Brite
Enzymes [BR:kpg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KPNIH32_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
75471..76091
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVENFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctataccctgccatccctgccttacgcttacgatgctctggaaccgcacttcgac
aagcagacgatggagatccatcacactaaacaccaccagacctacgtgaacaatgccaac
gccgcgctggaaagcctgccggagttcgctaacctgtccgctgaagagctgattaccaag
ctggatcagctgccggctgacaaaaaaaccgtactgcgtaacaacgccggcggccacgcg
aaccacagcctgttctggaaaggcctgaaaaccggtaccaccctgcagggcgacctgaaa
gcggctatcgagcgcgatttcggttccgtggagaacttcaaagcggaattcgaaaaagcc
gctgctacccgtttcggctccggctgggcgtggctggtcctgaaaggtgataaactggcc
gttgtctccaccgccaaccaggattccccgctgatgggcgaagccatttccggcgcttcc
ggcttcccgattatcggcctggacgtctgggaacacgcttactacctgaaattccagaac
cgccgcccggactacatcaaagccttctgggacgtagtgaactgggacgaagctgcagcg
cgttttgccgccaaaaaataa

DBGET integrated database retrieval system