KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_10435Help
Entry
KPNIH32_10435     CDS       T03468                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Pathway
kpg00020  Citrate cycle (TCA cycle)
kpg00480  Glutathione metabolism
kpg01100  Metabolic pathways
kpg01110  Biosynthesis of secondary metabolites
kpg01120  Microbial metabolism in diverse environments
kpg01130  Biosynthesis of antibiotics
kpg01200  Carbon metabolism
kpg01210  2-Oxocarboxylic acid metabolism
kpg01230  Biosynthesis of amino acids
Module
kpg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpg_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kpg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPNIH32_10435
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KPNIH32_10435
Enzymes [BR:kpg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     KPNIH32_10435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AIW76105
UniProt: A0A1Y0Q354
LinkDB All DBs
Position
2091642..2092892
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGQKITLQNGKLNVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEVYTGEKSTHVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFLR
DEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWVKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtagttccggcggaaggtcaaaaaatcaccctgcaaaacggcaaa
ctgaacgtccctcacaatccgattatcccgttcattgaaggtgacggtatcggcgttgac
gttaccccagcgatgctgaaagtggttgatgccgccgttgagaaagcctataagggcgag
cgtaaaatttcctggatggaagtttacaccggtgagaaatcaacccacgtctatggccag
gacgtctggctgccagctgaaaccctcgatctgattcgtgactaccgcgttgctatcaaa
ggtcctctgaccaccccagtcggcggcggcattcgttctctgaacgtggcgctgcgccag
gagctggatctttacgtctgcctgcgtccggtacgttactaccagggcaccccgagcccg
gttaaacacccggaactgaccgacatggttatcttccgtgaaaactcagaagatatctat
gcgggtatcgagtggaaagccgactctgcggaagcagacaaagtgatcaaattcctgcgc
gatgagatgggcgtgaagaaaattcgcttcccggaacattgcggcatcggcatcaagccg
tgctctgaagaaggcaccaaacgcctggtgcgcgccgcgattgaatacgcgatcaccaac
gatcgtgattccgtcactctggtgcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggctaccagctggctcgcgaagagttcggcggcgagctgatcgacggc
ggtccgtgggtgaaaatcaagaacccgaacaccggcaaagagatcgtggtgaaagacgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggcgactatatctctgacgccctggcggcgcaggttggcggtatc
ggtatcgccccgggcgccaacatcggtgacgagtgcgcgctgttcgaagcgactcacggt
actgcgccgaagtatgccggccaggacaaagtgaacccgggctccatcatcctgtccgca
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgatcgtcaaaggcatg
gaaggcgctatcgccgccaagaccgtgacctatgacttcgaacgtctgatggaaggcgct
aaactgctgaaatgtagcgagtttggcgacgcgattatcgcgaatatgtaa

DBGET integrated database retrieval system