KEGG   Kibdelosporangium phytohabitans: AOZ06_10200Help
Entry
AOZ06_10200       CDS       T04088                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
kphy  Kibdelosporangium phytohabitans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2221192..2222235
Genome map
AA seq 347 aa AA seqDB search
MPPVKPMLAKAVHEVPRTPGLSYEPKWDGFRCVVFRDGDEIELGSRNDRPLTRYFPELVE
LLREALPRRCVVDGEIVIVTDAGLDFEVLQLRLHPAASRVNKLAVQTPASFVAFDLLALD
DRSLMDEPFGERRRLLESVLDDKLARVHLTPLTTDPDVAQDWFTRFEGAGFDGVMAKPVD
HPYEPDKRVMWKVKHERTADCVVAGFRWHKDGESVGSLLLGLFDDRGTMHHVGVATSFTA
ARRRELVTELAPLRENALEDHPWREWAQAHAEQRVPGAYSRWAVGKDLSWVPLRPEWVAE
VRYEHVQGRRFRHGSRLVRFRHDRTPESCTYAQLDEVAPAELGLLFG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggtgaagccgatgctggccaaggccgtgcacgaagtgccgcgcacgccggga
ctgagctacgagccgaagtgggacgggttccggtgcgtggtgttccgggacggcgacgag
atcgagctgggttcgcgcaacgaccggccgttgacccggtacttcccggaactggtcgag
ctgctgcgggaggccttgccgcggcggtgcgtggtggacggtgagatcgtcatcgtgacc
gacgccggtctggacttcgaggtgctgcaactgcggctgcacccggcggcctcgcgggtg
aacaaactggccgtgcagacaccggccagtttcgtcgccttcgacctgctggcgctcgac
gaccgatcgctgatggacgagccgttcggcgagcggcgccgtctgctggaaagtgtgctg
gacgacaagctcgcgcgtgtgcacctgaccccgttgaccacggacccggacgtcgcgcag
gactggttcacccggttcgagggcgcggggttcgacggcgtgatggccaaaccggtcgac
cacccgtacgagccggacaaacgcgtgatgtggaaggtcaagcacgagcggacggcggac
tgcgtggtggcgggcttccgctggcacaaggacggcgagtcggtcgggtcgctgctgctc
ggtttgttcgacgaccggggcacgatgcaccacgtcggcgtggccaccagcttcaccgcg
gcgcgccgccgtgaactcgtgaccgagctggcaccgctgcgggagaacgcgctggaggac
cacccgtggcgtgaatgggcacaagcacacgccgagcagcgggtcccgggcgcgtacagc
cgctgggcggtcggcaaggacctgtcctgggtgccgctgcgacccgaatgggtggccgag
gtgcggtacgaacacgtgcagggcaggcggttccggcacggcagccgcctggtgcggttc
cgtcacgaccgcacgccggaatcctgcacgtacgcgcagctcgacgaggtcgctccggct
gaattggggttgctgttcggctag

DBGET integrated database retrieval system