KEGG   Klebsiella pneumoniae CG43: D364_13715Help
Entry
D364_13715        CDS       T02866                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
kpi  Klebsiella pneumoniae CG43
Brite
Enzymes [BR:kpi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     D364_13715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_2 GST_C GST_N_3 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AGX38789
LinkDB All DBs
Position
2874684..2875313
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELAYRLIRVDIGKGEQFHPQFLAISPNNKVPAIVDHMP
ADGGAPLSVFESGAILLYLAEKSGKLLSGELRERYVTLQWLFWQVGGLGPMLGQNQHFSH
SAPQTVPYAIERFQVETQRLYGVLNQRLGCSPWLGGDHYSIADIAAWPWVNCHVRQRIDL
ANYPAVHNWYERIKQRPATAEAMLKIQLY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctttactatgcacccaccccaaacggccacaaaatcaccctgttcctcgaa
gaggcggagctagcctatcggctaattcgggtcgatatcggcaaaggggaacaatttcat
ccgcagtttctggcgatttcgccgaataataaagttccggctatcgtcgaccacatgcct
gctgacggcggggcgccgttgagcgttttcgagtcaggcgccatcctgctctatctggcg
gaaaaaagcggtaagctgctgagcggcgagctgcgggaacgctacgtcacgctgcagtgg
ctgttctggcaggtcggcgggctggggccgatgctggggcaaaatcaacatttttcccac
tccgcgccgcaaaccgtgccctacgctattgaacgttttcaggtggaaacccaacgactg
tatggggtgctaaatcagcgtctgggatgcagcccgtggcttggcggcgaccactacagt
atcgccgacatcgccgcctggccctgggtgaactgccatgtccgacagcgtatcgatctg
gcgaactatccggcggtgcacaactggtatgagcgcattaagcagcggccggcaacggcg
gaagcgatgttaaaaattcagctttattaa

DBGET integrated database retrieval system