KEGG   Kocuria palustris: KPaMU14_08960Help
Entry
KPaMU14_08960     CDS       T04045                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kpl  Kocuria palustris
Pathway
kpl00010  Glycolysis / Gluconeogenesis
kpl00071  Fatty acid degradation
kpl00350  Tyrosine metabolism
kpl00625  Chloroalkane and chloroalkene degradation
kpl00626  Naphthalene degradation
kpl01100  Metabolic pathways
kpl01110  Biosynthesis of secondary metabolites
kpl01120  Microbial metabolism in diverse environments
kpl01130  Biosynthesis of antibiotics
kpl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPaMU14_08960
  Lipid metabolism
   00071 Fatty acid degradation
    KPaMU14_08960
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPaMU14_08960
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPaMU14_08960
   00626 Naphthalene degradation
    KPaMU14_08960
Enzymes [BR:kpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPaMU14_08960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C DUF1726 adh_short ThiF
Motif
Other DBs
NCBI-ProteinID: ALB04436
LinkDB All DBs
Position
2046891..2047901
Genome map
AA seq 336 aa AA seqDB search
MSAAVVTAFGEDLEIEDMPLPEPGRDQALVRLIASGVCHTDLHAAHGDWPVKPEPPFVPG
HEGVGEVVAVGEGVTRVSVGDLVGNAWLWSACGECEHCQEGWETLCENQVNGGYSMNGSF
GQYMLVDARYCPLIPEGADPFEIAPVLCAGVTVYKGLKVTGVRPGQWVVISGVGGLGHIA
VQYAVAMGMRVIAVDVADDKLALAERHGAEITINAMGPDPAEAIQEAVGGAHGVLVTAVH
PDAFGQAIGMVRRGGTIVFNGLPPGDFPAPIFDIVLKGLTIRGSIVGTRRDMEEALEFYS
RGLIHPTFSKRPLNEINEVLDEMDHGKIEGRVVLEY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgcggtcgtgaccgccttcggcgaggacctcgagatcgaggacatgcccctg
cccgagccggggcgcgaccaggccctcgtacggctgatcgcctccggcgtctgccacacg
gacctgcacgccgcgcacggcgactggcccgtcaagcccgagccgcccttcgtcccgggc
cacgagggcgtgggcgaggtcgtcgccgtcggcgagggcgtcacccgcgtgtccgtcggc
gacctcgtgggcaatgcctggctgtggagcgcgtgcggggaatgcgagcactgccaggag
ggctgggagacgctgtgcgagaaccaggtcaacggcggctacagcatgaacggctccttc
gggcagtacatgctcgtggacgcccgctactgcccgctgatcccggagggagccgatccc
ttcgagatcgccccggtgctgtgcgccggtgtcacggtctacaaggggctcaaggtgacg
ggggtgcgccccggccagtgggtcgtgatctccggagtcggcggcctgggccatatcgcc
gtgcagtacgcggtggccatgggcatgcgcgtgatcgcggtcgacgtcgccgatgacaag
ctcgccctcgccgagcgccacggcgccgagatcaccatcaacgccatgggcccggacccc
gccgaggccatccaggaggccgtcggcggagctcacggagtcctggtgacggcggtgcac
ccggatgccttcggccaggccatcggcatggtccgccgcggcgggaccatcgtgttcaac
ggcctgccgccaggcgacttcccggccccgatcttcgacatcgtgctcaaggggctgacc
atccgcggctcgatcgtcggcacccgcagggacatggaggaggccctggagttctactcc
cgcggtctgatccacccgacgttcagcaagcgcccgctgaacgagatcaacgaggtcctg
gacgagatggaccacgggaagatcgagggccgcgtggtgctcgagtactga

DBGET integrated database retrieval system