KEGG   Klebsiella pneumoniae 32192: KU54_010375Help
Entry
KU54_010375       CDS       T03746                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00240  Pyrimidine metabolism
kpne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpne00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KU54_010375
Enzymes [BR:kpne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     KU54_010375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AJB57157
UniProt: A0A0F0JWA4
LinkDB All DBs
Position
2082326..2082943
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAR
LYNPQTSLFDDIAAEHQLKPIHCVLVDESQFLTREQVHELSEVVDTLDIPVLCYGLRTDF
RGELFTGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQEGRPYNEGEQVVIGGNERYVS
VCRKHYKEALSVGSLTKVQNQHRPC
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttctactactctgcaatgaatgcaggtaagtcgaccgctctgttg
caatcttcgtacaattaccaggagcgggggatgcgtaccgtcgtttataccgctgagatt
gatgaccgctttggcgccggaaaagtcagttcgcgtatcgggctctcctcgccggcccga
ttgtataatccacagacctcgttatttgacgatattgcggcggagcaccagctaaagccg
attcactgcgtgctggtggatgaaagccagtttctgacgcgtgaacaggttcatgagctg
tccgaagttgtcgatacgctggatattccggtgctttgctatgggttgcggacggacttt
cgcggtgagctctttaccggcagccagtatttactggcctggtcagataagctggttgag
ctgaaaacgatctgcttctgcggccgcaaggccagcatggtattgcgcctcgatcaggag
gggcgtccttataatgagggtgagcaggtcgtcatcggcggtaatgagcggtacgtatcg
gtctgccgtaagcattataaagaggcgctgagcgtcggttcgttaaccaaggtacaaaac
cagcaccgtccctgctga

DBGET integrated database retrieval system