KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_04035Help
Entry
KPN2242_04035     CDS       T01982                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KPN2242_04035
   00790 Folate biosynthesis
    KPN2242_04035
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KPN2242_04035
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KPN2242_04035
Exosome [BR:kpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPN2242_04035
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpo00537]
 Enzymes
  KPN2242_04035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
875602..877017
Genome map
AA seq 471 aa AA seqDB search
MKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITTPGGAHRLTGDQTEALRASLI
NKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQIVTDAASLAAATEASQDKPLLGLFADGNMPVRWEGPKASYHGN
IDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTHDGAVM
VMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFTTMKAALSLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaagcgccctgtttattgccctgattcctctactgggctcgccggttattcat
gcagaaactactgctgcgccggttctggaaaatcgcgctgcgcagggagatatcaccact
cctggcggcgcgcatcgtttaacaggcgatcaaaccgaagcgctgcgcgcctcgttaatc
aataagccagctaaaaacgttattttgctgattggcgatggcatgggtgattcggaaatt
accgctgcgcgaaactatgccgagggggcgggcggtttctttaaaggaattgatgctctg
ccgttaaccgggcagtacacgcattattcgctggataaaaaaaccgggaaaccggactac
gtgaccgactcggcggcctccgccaccgcctggaccaccggcgtgaagacttataacggc
gcgctgggcgtcgatattcatgagaatgcgcatcagaccatcctcgagctggcgaaagcg
gcggggctggccaccggcaacgtttccaccgccgagctgcaggacgccacccccgcggcg
ttggtagcgcatgtgacatcgcgtaaatgctacggcccgacggttaccagcgaaaaatgc
cctagcaatgcgctggaaaaagggggcaaaggctccattaccgaacagctgctgaacgcc
cgaccggatgtcaccctgggcggcggcgcgaagacctttgccgaaacggcgacggcgggc
gagtggcagggcaaaaccctgcgcgagcaggcgcaagcgcgcggctaccagattgtgacc
gacgcggcttctcttgccgccgcgacggaagccagtcaggataaaccgctgctgggactc
tttgccgatggcaatatgccggtacgctgggaagggccgaaggcgtcttatcacggtaat
atcgataagccgccggtgacctgtacgccaaacccgaagcgtgacgcctcggtgccgacg
ctggcgcaaatgacggagaaagcgattgacctgctgagtcgcaacgagaaaggtttcttc
ctgcaagtcgaaggcgcttccatcgataagcaggaccatgcggccaatccgtgcggccag
atcggcgaaacggttgatcttgacgaagcggtgcagaaggcgctggaattcgcgcgaaaa
gacggtaataccctggtgatcgtcaccgccgaccatgcgcatgccagccagatcatcccg
gcggatagcaaagccccggggctgacccaggctctgaacacgcacgatggcgcggtgatg
gtgatgagctacggcaactctgaggaagagtcgatggagcacaccggcacccaactgcgc
attgcggcctacggtccgcatgcggctaacgtcgtcggcctgaccgatcagaccgacctg
ttcacgaccatgaaagctgccctgagtctcaaataa

DBGET integrated database retrieval system