KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_2014Help
Entry
KPR_2014          CDS       T02793                                 

Gene name
yfcG
Definition
(GenBank) highly similar to putative glutathione S-transferase domain protein from Escherichia coli strain ATCC 33849 - DSM 4235 - NCIB 12045 - K12 - DH1 (tr|C9QR05)
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Brite
Enzymes [BR:kpr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     KPR_2014 (yfcG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2104400..2105029)
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELAYRLIRVDIGKGEQFHPQFLAISPNNKVPAIVDHMP
ADGGAPLSIFESGAILLYLAEKSGKLLSGELRERYVTLQWLFWQVGGLGPMLGQNQHFSH
SAPQTVPYAIERFQVETQRLYGVLNQRLGCSPWLGGDHYSIADIAAWPWVNCHVRQRIDL
ANYPAVHNWYERIKQRPATAEAMLKIQLY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctttactatgcacccaccccaaacggccacaaaatcaccctgttcctcgaa
gaggcggagctagcctatcggctaattcgggtcgatatcggcaaaggggaacaatttcat
ccgcagtttctggcgatttcgccgaataataaagttccggctatcgtcgaccacatgcct
gctgacggcggggcgccgttgagcattttcgagtccggcgccatcctgctctatctggcg
gaaaaaagcggtaagctgctgagcggcgagctgcgggaacgctacgtcacgctgcagtgg
ctgttctggcaggtcggcgggctggggccgatgctggggcaaaatcaacatttttcccac
tccgcgccgcaaaccgtgccctacgctattgaacgttttcaggtggaaacccaacgactg
tatggggtgctaaatcagcgcctgggatgcagcccgtggcttggcggcgaccactacagt
atcgccgacatcgccgcctggccctgggtgaactgccatgtccgacagcgtatcgatctg
gcgaactatccggcggtgcacaactggtatgagcgcattaagcagcggccggcaacggcg
gaagcgatgttaaaaattcagctttattaa

DBGET integrated database retrieval system