KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_2189Help
Entry
KPR_2189          CDS       T02793                                 

Gene name
icdA
Definition
(GenBank) hihly similar to isocitrate dehydrogenase [NADP] from Escherichia coli O6 (tr|Q8FIB3)
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPR_2189 (icdA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KPR_2189 (icdA)
Enzymes [BR:kpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     KPR_2189 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2290232..2291482
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGQKITLQNGKLNVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEVYTGEKSTHVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFLR
DEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWVKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtagttccggcggaaggtcaaaaaatcaccctgcaaaacggcaaa
ctgaacgtccctcacaatccgattatcccgttcattgaaggtgacggtatcggcgttgac
gttaccccagcgatgctgaaagtggttgatgccgccgttgagaaagcctataagggcgag
cgtaaaatttcctggatggaagtttacaccggtgagaaatcaacccacgtctatggccag
gacgtctggctgccagctgaaaccctcgatctgattcgtgactaccgcgttgctatcaaa
ggtcctctgaccaccccagtcggcggcggcattcgttctctgaacgtggcgctgcgccag
gagctggacctctacgtctgcctgcgtccggtacgttactaccagggcaccccgagcccg
gttaagcaccctgaactgaccgatatggttatcttccgtgaaaactcagaagatatctat
gccggtatcgagtggaaagccgactctgcggaagcagacaaagtcatcaaattcctgcgc
gatgagatgggcgtgaagaaaattcgcttcccggaacattgcggtatcggcatcaagccg
tgctctgaagaaggcaccaaacgcctggttcgcgccgcgattgaatacgcgatcactaac
gatcgtgattccgtcactctggtgcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggctaccagctggctcgcgaagagttcggcggcgagctgatcgacggc
ggcccgtgggtgaaaatcaagaacccgaacaccggcaaagagatcgtggtgaaagacgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggcgactacatctctgacgccctggcggcgcaggttggcggtatc
ggtatcgccccgggcgccaacatcggcgacgagtgcgcgctgttcgaagcgactcacggt
actgcgccgaagtatgccggccaggacaaagtgaacccgggctccatcatcctgtccgca
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgattgtcaaaggcatg
gaaggcgctatcgccgccaagaccgtgacctatgacttcgaacgtctgatggaaggcgct
aagctgctgaaatgttcagaatttggcgacgcgattatcgcgaatatgtaa

DBGET integrated database retrieval system