KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_3035Help
Entry
KPR_3035          CDS       T02793                                 

Gene name
sodF
Definition
(GenBank) highly similar to superoxide dismutase [Fe] from Salmonella typhimurium (sp|P0A2F4)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Brite
Enzymes [BR:kpr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KPR_3035 (sodF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3110358..3110939
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQAYVTNLNNLIKGTAFEGKSLEEIVRTS
EGGVFNNAAQVWNHTFYWNSLAPNAGGEPEGELAAAIAKSFGSFADFKAKFTDAAAKNFG
AGWTWLVKNADGSLAIVSTSNAGTPLTTDAKPLLTVDVWEHAYYIDYRNARPSYLDHFWA
LVNWKFVAANLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgaattacctgcattaccatatgcaaaagacgccctggcgccgcacatttcc
gcagaaaccctggaatatcactacggtaaacaccaccaggcgtatgtcactaacctcaac
aacctgatcaaaggcactgcgttcgaaggcaaatccctcgaagagatcgtccgcacttct
gaaggcggcgtattcaacaacgcagcgcaggtctggaaccacaccttctactggaacagc
ctggcgcctaacgccggcggcgaaccggaaggcgaactggcggccgcaatcgccaaatct
ttcggcagcttcgcggattttaaagccaaatttaccgatgccgcggcgaaaaacttcggc
gctggctggacctggctggtcaaaaatgccgacggcagcctggctatcgtctccaccagc
aacgccggcaccccgctgaccaccgacgcgaagccgctgctgaccgttgacgtttgggaa
catgcctactacatcgactaccgcaacgcccgtccaagctacctggaccacttctgggcg
ctggtaaactggaagtttgttgcggctaacctggcggcataa

DBGET integrated database retrieval system