KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_4823Help
Entry
VK055_4823        CDS       T03418                                 

Definition
(GenBank) disulfide bond reductase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Brite
Enzymes [BR:kpt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     VK055_4823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4943235..4943864)
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELAYRLIRVDIGKGEQFHPQFLAISPNNKVPAIVDHMP
ADGGAPLSVFESGAILLYLAEKSGKLLSGELRERYVTLQWLFWQVGGLGPMLGQNQHFSH
SAPQTVPYAIERFQVETQRLYGVLNQRLGCSPWLGGDHYSIADIAAWPWVNCHVRQRIDL
ANYPAVHNWYERIKQRPATAEAMLKIQLY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctttactatgcacccaccccaaacggccacaaaatcaccctgttcctcgaa
gaggcggagctagcctatcggctaattcgggtcgatatcggcaaaggggaacaatttcat
ccgcagtttctggcgatttcgccgaataataaagttccggctatcgtcgaccacatgcct
gctgacggcggggcgccgttgagcgttttcgagtcaggcgccatcctgctctatctggcg
gaaaaaagcggtaagctgctgagcggcgagctgcgggaacgctacgtcacgctgcagtgg
ctgttctggcaggtcggcgggctggggccgatgctggggcaaaatcaacatttttcccac
tccgcgccgcaaaccgtgccctacgctattgaacgttttcaggtggaaacccaacgactg
tatggggtgctaaatcagcgtctgggatgcagcccgtggcttggcggcgaccactacagt
atcgccgacatcgccgcctggccctgggtgaactgccatgtccgacagcgtatcgatctg
gcgaactatccggcggtgcacaactggtatgagcgcattaagcagcggccggcaacggcg
gaagcgatgttaaaaattcagctttattaa

DBGET integrated database retrieval system