KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_3312Help
Entry
KP1_3312          CDS       T00910                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00240  Pyrimidine metabolism
kpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KP1_3312 (tdk)
Enzymes [BR:kpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     KP1_3312 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: BAH63928
LinkDB All DBs
Position
complement(3138996..3139613)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAR
LYNPQTSLFDDIAAEHQLKPIHCVLVDESQFLTREQVHELSEVVDTLDIPVLCYGLRTDF
RGELFTGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQEGRPYNEGEQVVIGGNERYVS
VCRKHYKEALSVGSLTKVQNQHRPC
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttctactactctgcaatgaatgcaggtaagtcgaccgctctgttg
caatcttcgtacaattaccaggagcgggggatgcgtaccgtcgtttataccgctgagatt
gatgaccgctttggcgccggaaaagtcagttcacgtatcgggctctcctcgccggcccga
ttgtataatccacagacctcgttatttgacgatattgcggcggagcaccagctaaagccg
attcactgcgtgctggtggatgaaagccagtttctgacgcgtgaacaggttcatgagctg
tccgaagttgtcgatacgctggatattccggtgctttgctatgggttgcggacggacttt
cgtggtgagctctttaccggcagccagtatttactggcctggtcagataagctggttgag
ctgaaaacgatctgcttctgcggccgcaaggccagcatggtattgcgcctcgatcaggag
gggcgtccttataatgagggtgagcaggtcgtcatcggcggtaatgagcggtacgtatcg
gtctgccgtaagcattataaagaggcgctgagcgtcggttcgttaaccaaggtacaaaac
cagcaccgtccctgctga

DBGET integrated database retrieval system