KEGG   Klebsiella pneumoniae PMK1: PMK1_00189Help
Entry
PMK1_00189        CDS       T03419                                 

Gene name
yfcG_1
Definition
(GenBank) Disulfide-bond oxidoreductase YfcG
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
kpx  Klebsiella pneumoniae PMK1
Brite
Enzymes [BR:kpx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     PMK1_00189 (yfcG_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
229331..229960
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELAYRLIRVDIGKGEQFHPQFLAISPNNKVPAIVDHMP
ADGGAPLSVFESGAILLYLAEKSGKLLSGELRERYVTLQWLFWQVGGLGPMLGQNQHFSH
SAPQTVPYAIERFQVETQRLYGVLNQRLGCSPWLGGDHYSIADIAAWPWVNCHVRQRIDL
ANYPAVHNWYERIKQRPATAEAMLKIQLY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctttactatgcacccaccccaaacggccacaaaatcaccctgttcctcgaa
gaggcggagctagcctatcggctaattcgggtcgatatcggcaaaggggaacaatttcat
ccgcagtttctggcgatttcgccgaataataaagttccggctatcgtcgaccacatgcct
gctgacggcggggcgccgttgagcgttttcgagtcaggcgccatcctgctctatctggcg
gaaaaaagcggtaagctgctgagtggcgagctgcgggaacgctacgtcacgctgcagtgg
ctgttctggcaggtcggcgggctggggccgatgctggggcaaaatcaacatttttcccac
tccgcgccgcaaaccgtgccctacgctattgaacgttttcaggtggaaacccaacgactg
tatggggtgctaaatcagcgtctgggatgcagcccgtggcttggcggcgaccactacagt
atcgccgacatcgccgcctggccctgggtgaactgccatgtccgacagcgtatcgatctg
gcgaactatccggcggtgcacaactggtatgagcgcattaagcagcggccggcaacggcg
gaagcgatgttaaaaattcagctttattaa

DBGET integrated database retrieval system