KEGG   Klebsiella quasivariicola: B8P98_01500Help
Entry
B8P98_01500       CDS       T05116                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kqv  Klebsiella quasivariicola
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kqv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B8P98_01500
   00650 Butanoate metabolism
    B8P98_01500
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B8P98_01500
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B8P98_01500
Enzymes [BR:kqv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B8P98_01500
Amino acid related enzymes [BR:kqv01007]
 Aminotransferase (transaminase)
  Class III
   B8P98_01500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
311969..313234
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVADQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLREVLNQARTTCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRLVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARVLK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggaaaacgccacgctgtgggatatcgaaggcaac
gaggtgatcgatttcgccgccgggatcgccgtgttaaataccggtcaccgtcatccgaaa
gtggtcgccgcggtcgccgaccagctgcaggcgttcacccacactgcctatcagattgtg
ccgtacgaaagctatgtttcgctggcggagcgtatcaacgatctggcgccaattgacggg
ccggcaaaaacagctttcttcaccaccggcgcggaagcggtcgagaacgcggtgaaaatc
gcccgcgcttacaccggtcgtccgggcctgattacttttggcggcggcttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcgccttacaaaatcggcttcgggccg
ttcccgggctcggtgtatcacggcgtttaccccaatgcggcgcacggcgtgaccaccgcg
gatgcgctgaaaagcctggaacgtattttcaaggcagatatcgcgccggatcaggtagcg
gccatcatcctcgagccgatccagggggaaggcggttttaacgttgcaccggccgatttt
atgcaggcgctgcgcgacctgtgtgatacccacggcattctgctgatcgccgatgaagtg
cagaccggttttgcccgcaccggcaagctgttcgccatgcagcactatgaggtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgttgtcggt
cgcgccgaggtgatggatgcgccagcgccaggcggactgggcgggacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtgattgccgaagagcaattgtgc
cagcgtgccgaacagctgggtagccatctgcgggaagtgctcaaccaggcgcgtaccact
tgcccggcgattgttgatgtccgcggtcgagggtcgatggtggcggtggagtttaacgat
ccgcaaactggcgagccgtcgccggagttcacccgtcttgtgcaacagaaagcgcaggaa
aacggcctgctgctgctgagctgcggcgtctacggcaacgtgatccgcttcctgtatccg
ttgactatcccggatgcccagttctcgaaagcgctggatattctggcgcgcgtactgaag
agctaa

DBGET integrated database retrieval system