KEGG   Kosakonia radicincitans: A3780_23220Help
Entry
A3780_23220       CDS       T04579                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
krd  Kosakonia radicincitans
Pathway
krd00250  Alanine, aspartate and glutamate metabolism
krd00410  beta-Alanine metabolism
krd00640  Propanoate metabolism
krd00650  Butanoate metabolism
krd01100  Metabolic pathways
krd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:krd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A3780_23220
   00650 Butanoate metabolism
    A3780_23220
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A3780_23220
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3780_23220
Enzymes [BR:krd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A3780_23220
Amino acid related enzymes [BR:krd01007]
 Aminotransferase (transaminase)
  Class III
   A3780_23220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: APG20334
LinkDB All DBs
Position
complement(4995124..4996389)
Genome map
AA seq 421 aa AA seqDB search
MKNNELHQRRLQATPRGIGVMCGFYAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VMAAVEKQLQAFTHTAYQIVPYESYVSLAERINERVPVDGPAKTAFFSTGAEAVENAVKI
ARAYTKRPGVITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSIYHAQYPNALHGVSTE
DALKSLERIFKADIAPDQVAAILLEPVQGEGGFNVAPADFMNALRKLCDSHGILLIVDEV
QSGFARTGKLFATEYYDVKPDLITMAKSLAGGLPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIDEENLCERANHLGKHLVEVLTQAKAQCSYIADIRSQGSMVAVEFND
PSTGAPSPEFTKQVQDKALAAGVLLLSCGVYGNVIRFLYPLTIPEVQFRKALDIIHQSLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaataacgaactacatcagcgccgtttacaggcgacgccgcgcggtattggagtg
atgtgcgggttttatgcggaaaaagcagaaaatgccacattatgggatgtcgaaggcaac
gaagtcatcgacttcgctgccgggatcgcggtgctcaataccgggcatcgtcacccgaaa
gtaatggctgcggtggaaaagcagttgcaggcatttacgcacaccgcttaccaaatcgtt
ccttacgaaagctatgtttcgctggcggaacgtattaacgaacgcgtgcccgttgatggc
ccggcgaaaacggcgtttttctcaaccggcgcggaagcggtggagaacgcggtgaaaatt
gcccgcgcttacaccaaacgccctggcgtgattaccttcggcggcggttttcatggccgt
acgtttatgaccatggcgctgaccgggaaggttgccccgtacaaaatcgggtttggtccg
ttccccggctcgatttaccacgcacaatatccgaatgcgctgcatggcgtcagtaccgaa
gatgcgctgaaaagtctcgaacgcatttttaaagcggatatcgcgccggatcaggttgcg
gccatcctgctggagccggttcagggcgaaggcggctttaacgtggcgccagcggatttc
atgaacgcgctgcgcaaactgtgcgacagccacggcattcttttgattgttgatgaagtg
cagagcggctttgcccgtaccggcaaattgttcgcgaccgagtattacgatgttaaaccg
gatctgatcaccatggcgaaaagcctggcgggcgggttgccgctatcggcggtggcaggg
cgtgcagaggtgatggatgcgcctgcgcctggcgggctgggcggcacttacgctggtaac
ccgctggcggtggccgcagcacacgcggtgctggatgtgattgacgaagagaacctctgt
gaacgcgctaaccatctgggcaaacatctggtggaagtgctgacgcaggcaaaagcgcag
tgctcgtacatcgcggatatccgctcgcagggctcgatggtggctgtggaatttaacgat
cccagtaccggtgcgccatcgcctgaatttaccaaacaggtacaggacaaggcgctggct
gcaggtgtgctgctgctgagctgcggtgtctacggcaacgtgatccgtttcctctatccg
ttaaccattccggaagttcagttccgcaaagcgctggatattatccaccagtcgctgacc
cgctaa

DBGET integrated database retrieval system