KEGG   Kocuria rhizophila: KRH_07610Help
Entry
KRH_07610         CDS       T00701                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
krh  Kocuria rhizophila
Pathway
krh00010  Glycolysis / Gluconeogenesis
krh00071  Fatty acid degradation
krh00350  Tyrosine metabolism
krh00625  Chloroalkane and chloroalkene degradation
krh00626  Naphthalene degradation
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01130  Biosynthesis of antibiotics
krh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KRH_07610 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    KRH_07610 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    KRH_07610 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KRH_07610 (adh)
   00626 Naphthalene degradation
    KRH_07610 (adh)
Enzymes [BR:krh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KRH_07610 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short TrkA_N ELFV_dehydrog TRAM ThiF
Motif
Other DBs
NCBI-ProteinID: BAG29108
NITE: KRH_07610
UniProt: B2GK88
LinkDB All DBs
Position
827223..828233
Genome map
AA seq 336 aa AA seqDB search
MNAAEVEAFGEDLVVGEHEIPEPGPHQALVKLIASGVCHTDLHAAGGDWPVKPKLPLIPG
HEGVGIVEKLGPDVTELEVGQMVGNAWLWSACGNCDHCRTGWETLCEQQVNGGYGIGGSF
GEYMLVDARYAAVIPEGADPYEIAPVLCAGVTVYKGLKQTEVKPGQWVVISGIGGLGHVA
VQYAVAMGMRVVAVDVADDKLALATEHGAEITVNAFAEDPAEVIQEKIGGSHGVLVTAVH
PQAFGQAIGMTRRGGTIVFNGLPPGDFPAPIFDIVLKGLTIRGSIVGTRQDMIEALEFYA
AGKIHPTFSKRPLEDINAIFDEMEHGKIDGRVVIEY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagcagaggtcgaggccttcggcgaggacctggtcgtcggcgagcacgagatc
ccggaaccggggccccaccaggccctcgtgaagctcattgcttccggggtgtgccacacg
gacctgcatgccgcgggaggggactggcccgtcaagcccaagcttcccctgatccccggt
cacgagggcgtgggcatcgtggagaagctcggtccggacgtcaccgagctcgaggtcggg
cagatggtcggaaatgcctggctgtggtccgcgtgcggcaactgcgaccactgccgcacc
ggctgggaaacgctgtgcgagcagcaggtcaacggcggctacggcatcggcggctccttc
ggggagtacatgctggtggacgcccgctacgccgctgtcattcccgagggtgcggatccc
tacgagatcgcacccgtgctgtgcgcgggagtgaccgtgtacaaggggctcaagcagacg
gaggtcaagccggggcagtgggtcgtgatctcgggcatcggcgggctcggacacgtggcg
gtgcagtacgcggtggccatgggcatgcgcgtggtggccgtggacgtcgcggacgacaag
ctggcgctggccaccgagcacggcgcggagatcacggtcaacgccttcgccgaggacccc
gcggaggtcatccaggagaagatcggcggcagccacggggtgctcgtcacggcggtgcac
ccgcaggccttcgggcaggccatcggcatgacccggcgcggtggcacgatcgtgttcaac
ggtctgcccccgggggacttcccggctccgattttcgacatcgtgctcaaggggctcact
atccgcgggtcgatcgtgggcacccgccaggacatgatcgaggccctggagttctacgcc
gccggcaagatccaccccacgttcagcaagcgtccgctcgaggacatcaacgcgatcttc
gacgagatggagcacggcaagatcgacggccgtgtggtgatcgagtactga

DBGET integrated database retrieval system