KEGG   Kosakonia sacchari: C813_23055Help
Entry
C813_23055        CDS       T03601                                 

Definition
(GenBank) thiol:disulfide oxidoreductase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ksa  Kosakonia sacchari
Brite
Enzymes [BR:ksa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     C813_23055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: AHJ77274
UniProt: W6JEF8
LinkDB All DBs
Position
complement(1517795..1518424)
Genome map
AA seq 209 aa AA seqDB search
MIDLYFAPTPNGHKITLFLEEAELEYRLIRVDISKGDQFRPDFLSISPNNKIPAIVDHLP
ADGGAPLSVFESGAILLYLAEKTGKLLSGELRERHLTLQWLFWQVGGLGPMLGQNHHFNH
FAPQPVPYAIERYQVETQRLYQVLNKRLERVPWLAGEHYSIADIAAWPWINAHARQRVDL
EDYPAVFNWFERIRTRPATERALQKAQQT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatagacctctattttgcgcccacaccaaacggtcataaaataacgctttttctggag
gaggcggagctggaatatcgcctgatccgtgtggatatcagcaagggcgatcagtttcgc
cccgactttctctccatctcccctaacaacaaaatcccggccattgtcgaccatctgccc
gccgatggcggcgcgccgcttagcgtgttcgaatccggagcgatcctgctttatctggcg
gaaaaaacagggaaattgctcagcggcgagctccgcgagcgccatcttacgctgcaatgg
ctgttctggcaggttggcgggctggggccgatgctcggacagaaccaccactttaaccac
tttgcgccgcagccggtgccctacgctattgagcgctaccaggtcgaaacccagcgtttg
tatcaggtactgaataaacgtcttgaacgtgtaccgtggctggcaggcgagcattacagc
attgccgatattgccgcctggccgtggatcaatgcccacgcgcgccagcgcgtcgatctg
gaagattacccggcggtatttaactggtttgagcgtattcgtacacgtccggcgaccgag
cgggcgctacagaaggcgcaacaaacgtaa

DBGET integrated database retrieval system