KEGG   Kangiella sediminilitoris: KS2013_1165Help
Entry
KS2013_1165       CDS       T04467                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ksd  Kangiella sediminilitoris
Brite
Enzymes [BR:ksd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     KS2013_1165
Peptidases [BR:ksd01002]
 Metallo Peptidases
  Family M2
   KS2013_1165
Exosome [BR:ksd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KS2013_1165
CD molecules [BR:ksd04090]
 Proteins
  KS2013_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1272125..1273969
Genome map
AA seq 614 aa AA seqDB search
MITLKRAVSAAILTSALLGHPVISTAAGSKDVTVEDAAAFVADAEKRLTDIAEYAARIAW
VNANFVTHDTTMLNAQVGEEYTKLGVELANEAKKFNGLDLPYDLNRKIEMIKLGLTLPAP
SDPKKTKQLAEISSKLDSIYAKGKSPDGRSLGELSQVLRESRDADEQLKAWTGWREISKE
MRPLYQQMVEIANEGSKELGYADTGTMWRSKYDMPADGFANEMDRLWGQVKPLYTALHCH
VRAELNEEYGDEVVSTDKPIPAHLLGNMWAQQWGNIYDIAGPDSAGEGIDIDPILREHYG
VDKDEVSHEEKEVAVKKMVKTAENFFSSLGFAPLPQTFWERSLFVKPRDRDVQCHASAWD
IDNEEDIRIKMCTEINGEDFQTVHHELGHNYYQRAYKDQPILYKGSANDGFHEAIGDTVA
LSITPKYLKQIGLIDEEPDASADIALLMRSALDKVAFLPFGLMVDQWRWKVFNGEISPEE
YNQGWWELRQKYQGIDAPVARTEDHFDPGAKYHIPGNTPYSRYFLAHILQFQFYREMCEM
AGNEGPLHRCSFYGNKEVGEKLIKMLEMGSSRPWPDALEAMTGSREMDATAVLEYYAPLK
TWLDEQNKGRNCGW
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgataactctaaaaagagccgtcagcgctgccatactgaccagcgccctgctgggccat
cccgttatctctactgctgctggcagcaaagacgtaactgttgaagacgcagctgctttt
gttgctgatgctgaaaagcgattaaccgatattgccgaatatgcagctcgtatcgcctgg
gtcaacgctaattttgtaacccacgatacaacgatgctgaacgcacaggttggtgaagag
tatacaaagcttggcgtagagcttgctaatgaagccaagaagtttaacggcctcgatctt
ccttacgaccttaaccgtaaaatcgaaatgatcaagcttggcctgacattaccagctcca
tcagacccgaaaaaaacaaaacaactagcagaaatcagctctaagttagacagtatttat
gcgaaaggcaaaagccctgatggccgtagcctgggcgaactaagtcaggtattacgggaa
tctcgagatgctgacgagcagctgaaggcctggactggctggcgtgaaatatctaaggaa
atgcgtcctctttaccagcagatggtagaaatcgccaacgaaggctctaaagagcttggc
tatgccgacacaggtactatgtggcgttcaaagtacgatatgcctgctgatggctttgct
aatgaaatggaccgtttatggggacaggtaaagcctctctatactgccctgcactgtcat
gtaagagccgagctgaatgaagagtatggtgatgaggtggtctcaacagacaaacctatc
ccagctcatcttctcggtaatatgtgggcacaacagtggggtaatatctacgatatcgct
ggtcctgacagtgccggtgaaggtattgatatcgatccaattctgcgtgaacactatggc
gttgataaagatgaagtcagtcatgaagagaaagaagtcgcggttaagaaaatggttaaa
acagccgaaaacttcttctcatctcttggcttcgctccattaccacaaaccttctgggag
cgttcgcttttcgtaaaaccgcgtgatcgcgatgtccaatgccatgccagcgcctgggat
attgataatgaagaagatattcgtattaagatgtgtactgaaatcaatggcgaagacttc
cagactgtacaccacgaacttggtcacaactactaccagcgtgcatacaaagatcagcca
atcttgtataaaggcagtgccaacgacggcttccatgaagctattggcgatacagtagcc
ctctcaatcacaccaaagtacctgaagcaaatcgggcttatcgacgaagaaccagatgcc
agcgctgatattgctttgttaatgcgttcagcattagacaaagttgcattcttacctttt
ggtttaatggtcgatcaatggcgttggaaagtattcaatggtgagatatcacctgaagaa
tacaaccagggctggtgggaactgcgtcaaaaataccagggcatcgatgctccggttgct
cgaaccgaagatcattttgacccaggtgcaaaataccatattcccggtaatacaccttac
tcacgttacttcctggctcacattctacagttccagttctatcgtgaaatgtgtgagatg
gctggcaacgaaggcccacttcaccgttgctctttctatggcaataaagaagtcggcgag
aagctaatcaagatgctagaaatgggctcttcacgtccttggcctgacgctcttgaagct
atgaccggtagccgtgaaatggatgcaacagcggtacttgagtactacgccccgctgaaa
acatggttggatgaacaaaacaaaggtcgtaactgtggctggtaa

DBGET integrated database retrieval system