KEGG   Kitasatospora setae: KSE_65520Help
Entry
KSE_65520         CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
complement(7363232..7364977)
Genome map
AA seq 581 aa AA seqDB search
MLARRAVEQPDELAYAFLHNGEEVAETLTYRQLDARARAVAARLTALRLAGRSVLLLHPS
GLGFVSDLLGCMYAGVAAAPVQVPSRARGLARLRAIADDAGTTVVLTTPEVRRDLLERFG
ALPELAGLTLHDPETLAAEAELTDPAAVAGWRPRPIGSEELALLQYTSGSTGTPKGVRVT
HANFGANVDETDRLWPCRGDARVVNWLPLFHDMGMLFGVVLPLWAGIPSYLMAPDAFIRR
PARWLEAVSRFGGTHAAAPSFAYELCVRAVGEEGLPSGLDLSSWRVAANGAEPVRWQTVR
AFTEALAPAGFRPEAMCPGYGLAENTLKATGSPEDRVPTVLWLSAEELRAGRAVRVPRSD
APGVLPAVGCGAVVGDSLVRIVDPVERTTRPEGRVGEIWVSGPCVASGYHGRPEESEETF
RARRSDRTEQRSWLRTGDLGFLADGELFVTGRIKDVVIRQGRNFYPQDIELSAESADPGL
HPNCAAAFSADDGTSERLVLVVEADGRTLRGGGELLRERIRRAVHENQRLEADEILLVRR
GSLPKTSSGKVQRRETLRRYLDGEFGSAQAVAPRERVEAGR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcccggcgcgccgtcgagcagcccgacgagctggcgtacgccttcctgcacaac
ggcgaggaggtcgccgagaccctgacctaccgccaactggacgccagggcgcgggcggtg
gcggcacggctgacggccctgcggctggccgggcgcagcgtgctgctgctgcacccgtcc
gggctggggttcgtctcggacctgctgggctgcatgtacgcgggagttgccgcggccccg
gtgcaagtaccgtcccgggctcgcgggttggcgcgactgcgggcgatcgcggacgacgcc
ggcaccaccgtggtgctgaccaccccggaggtgcggcgggacctgctggagcggttcggc
gcgctgcccgagctggcggggctgaccctgcacgaccccgagacgctggcggccgaggcc
gagctcaccgacccggcggcggtggcgggttggcggccgcggccgatcgggtccgaggag
ctggcgctgctgcagtacacctccgggtcgacggggacgccgaagggcgtgcgggtcacg
cacgccaacttcggtgccaacgtggacgagacggaccggctgtggccgtgccggggcgac
gcccgggtggtgaactggctgccgctcttccacgacatggggatgctgttcggcgtcgtg
ctgccgctgtgggcgggcatcccgtcgtacctgatggcgccggacgcgttcatccggcgg
ccggcccgctggctggaggcggtctcccggttcggcgggacgcacgcggcggcgcccagc
ttcgcgtacgagctgtgcgtgcgggcggtcggcgaggaggggctgccgtccgggctcgac
ctgtcgtcctggcgggtggcggcgaacggcgcggagccggtgcgctggcagacggtgcgg
gcgttcaccgaggcgctggccccggcggggttccggccggaggcgatgtgcccggggtac
gggctggcggagaacaccctgaaggcgaccggcagtccggaggaccgggtgccgacggtg
ctctggctgtccgcggaggagctgcgggcgggccgggcggtgcgggtgccgcgctccgac
gcccccggggtgctgccggcggtgggctgcggcgcggtggtcggcgacagcctggtgcgg
atcgtcgacccggtggagcgcaccacccggccggaggggcgggtcggcgagatctgggtg
agcggcccgtgcgtcgcgtccggctaccacggccgcccggaggagtccgaggagaccttc
cgggcccgccgcagcgaccgtaccgagcagcggagctggctgcgcacgggtgacctgggc
ttcctggccgacggcgagctgttcgtcaccggccggatcaaggacgtggtgatccggcag
ggccgcaacttctacccgcaggacatcgaactctccgcggagagcgccgacccgggcctg
cacccgaactgcgcggcggcgttctccgccgacgacggcaccagcgaacgcctggtcctg
gtggtcgaggcggacgggcggaccctgcgcggcggcggcgagctgctgcgcgagcggatc
cgccgggccgtgcacgagaaccagcggctggaggcggacgagatcctgctggtccgccgg
ggctcgctgccgaagacctccagcggcaaggtgcagcgccgggagaccctgcggcgctac
ctggacggcgagttcggctcggcccaggcggtcgcgccgcgcgaacgggtggaggcggga
cgatga

DBGET integrated database retrieval system