KEGG   Klebsiella variicola DX120E: KR75_00980Help
Entry
KR75_00980        CDS       T03531                                 

Definition
(GenBank) thiol:disulfide oxidoreductase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
kvd  Klebsiella variicola DX120E
Brite
Enzymes [BR:kvd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     KR75_00980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1454513..1455142)
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAQLAYRLIRVDIGKGEQFHPQFLAISPNNKIPAIVDHMP
VDGGAPLSVFESGAILLYLAEKSGKLLSGELRERYITLQWLFWQVGGLGPMLGQNQHFAH
SAPQTVPYAIERFQVETQRLYGVLNHRLEASPWLGGDHYSIADIAAWPWVNNHVRQRIDL
ANYPAVHNWYERIKQRPATIEAMLKIQPY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctctactatgcacccaccccaaacggccacaaaatcaccctgtttctcgaa
gaggcgcagctggcctatcggctaattcgggtcgatatcggcaaaggggagcagtttcat
ccacagtttctggcgatttcgccgaataacaaaatcccggcgattgtcgaccatatgcct
gtcgatggcggggcgccgttgagcgtcttcgagtccggcgccatcctgctctatctggcg
gagaaaagcggcaagctgctgagcggtgaactgcgggagcgctatattactctgcaatgg
ctattctggcaggtcggcggtcttgggccgatgctgggacaaaatcagcattttgcccac
tcggcgccgcaaacggtaccctatgccattgaacgttttcaggtggaaacccagcgactg
tacggggttctcaaccaccgcctcgaagccagtccgtggcttggcggcgaccattacagc
atcgccgatattgccgcctggccctgggtcaacaaccatgtccgacagcgtatcgatctg
gcgaactacccggcggtgcataactggtatgagcgcattaagcagcgaccggcgaccatt
gaagcgatgctaaaaattcagccttattaa

DBGET integrated database retrieval system