KEGG   Lysobacter antibioticus 76: LA76x_2137Help
Entry
LA76x_2137        CDS       T04154                                 

Definition
(GenBank) glutathione S-transferase, C-terminal domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lab  Lysobacter antibioticus 76
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lab00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LA76x_2137
Enzymes [BR:lab01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LA76x_2137
Transporters [BR:lab02000]
 Other Transporters
  Pores ion channels [TC:1]
   LA76x_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2442276..2442902
Genome map
AA seq 208 aa AA seqDB search
MYALYYSPGTASFVVHWLLIEMGIEHELRPVDMEARAHKNAEYLALNPNGVVPTLIVDGQ
PRYEAAGLAMFLADRHPQAGLAPALDDPQRAEYNQWMFNLANTLQSPLRLWWYPWDLQAG
DEAVRAGAQTRIEATCERLDAQLAKQGPYLLGERLSAADFYLTMLMRWTRKMPRPAHDWP
HLGAFAQRMKARPSFAAVYEREGLTEWA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgctctattattcgcccggcaccgccagcttcgtcgtccattggctgctcatc
gagatggggatcgagcacgaactgcggccggtcgatatggaagcccgcgcgcacaagaac
gccgagtacctggcgctgaatccgaacggggtggtaccgaccctgatcgtcgacggccag
ccgcgttacgaagccgcgggcctggcgatgtttctcgccgaccgccatccgcaggccggg
ctggcaccggcgctcgacgacccgcagcgcgccgagtacaaccagtggatgttcaaccta
gccaacaccctgcagtctccgctgcggctgtggtggtatccgtgggacctgcaggccggc
gacgaggcggtgcgtgccggtgcgcagacgcgcatcgaggccacttgcgagcgcctcgac
gcacagctcgccaagcagggcccgtacctgctcggcgaacgcctgagcgcggccgatttc
tacctgaccatgctgatgcgctggacccgcaagatgccgcggccggcgcacgactggccg
cacctgggcgcgttcgcgcagcggatgaaggcgcgaccgtccttcgccgccgtgtacgag
cgcgaagggctgaccgaatgggcttga

DBGET integrated database retrieval system