KEGG   Labrenzia sp. VG12: CHH27_03055Help
Entry
CHH27_03055       CDS       T04984                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00473  D-Alanine metabolism
labr01100  Metabolic pathways
labr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:labr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CHH27_03055 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CHH27_03055 (alr)
Enzymes [BR:labr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CHH27_03055 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:labr01011]
 Precursor biosynthesis
  Racemase
   CHH27_03055 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Ice_nucleation
Motif
Other DBs
NCBI-ProteinID: ASP32346
UniProt: A0A222F164
LinkDB All DBs
Position
complement(660908..662053)
Genome map
AA seq 381 aa AA seqDB search
MVSTSEHTSYSPSLYGGRLTIDLNAIACNWRFLNGQTGAKTECAAAIKADAYGTGQDKAA
PALYEAGCRTFFVAVPTEAIALRQVLPDAVVFALDGLFPDTYAHYLDNRIRPVLGSLEEL
QEWAGICKAAGQSFDAAVHVDTGIHRLGLSPAEFGAAMTDRSLLGPFRPSLIMSHLACGS
TPDHPMNRRQLELFRTVTDPFKSIPRSLANSAGVLMGPDFHFDMVRPGIALYGGQAIETT
PNQMKPVAKVEARIMIIRDVPEGDTIGYGATQTAKRPLRNAVVAAGYADGLLRRASSTDD
RPGGFGMIGGHKAPILGRISMDMITLDVTDVPEQLLKRGAFVEMLGPTVAATDLAAYAET
IDYEYLTSLGRRFERVYGLLT
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atcgtgtcgacttccgagcatacgtcctattcgccttctctttatggcggccgcctgacc
atcgacctgaacgcaatcgcttgcaactggcggtttctcaatggtcagaccggagccaaa
accgaatgcgccgcggcaatcaaggcagacgcatacgggacgggtcaggacaaggcggca
cctgcgctttacgaagctggttgccggacgttcttcgttgccgtgccgaccgaggcaatc
gccttgcggcaggtgttgccggacgccgtggtctttgcgctcgacggtttgtttcctgac
acctatgcgcattatctcgacaacaggatccgcccggttctcggcagcctggaagagctg
caggaatgggccggtatctgcaaggcggcggggcagtccttcgatgccgcagtccatgtc
gatacaggcattcaccggttgggactgtcgccggcagaatttggcgcagccatgaccgac
aggagcctgctcggcccgttccggccatcgctgatcatgagccacctcgcctgcggttca
acaccggaccatccgatgaaccggcgacagctcgagcttttcaggacggtgaccgatccg
ttcaagagtattccgcgctcgcttgccaactcggctggcgtgctgatgggaccggacttt
cactttgacatggtccgtccggggatcgcgctttatggcggacaggcaatcgagaccacg
ccgaaccagatgaaaccggttgccaaggttgaagcccgcatcatgatcatccgggatgtt
ccggagggcgacaccatcggctatggcgccacgcagacggccaagcgcccgctcaggaat
gccgttgttgcggccggatatgccgacggtcttttgcgcagggccagcagcacggacgac
cggccggggggcttcggtatgatcggcggccacaaggcgccaattctcggccggatttcc
atggacatgatcacgctggacgtaaccgatgtgccggagcagcttctgaaacgcggcgcg
tttgtggaaatgcttggtccaactgttgcggcaacggacctggccgcttatgcggagacc
atcgactacgaatatctgacaagcctcgggcggcgctttgagcgtgtctatggcctcctg
acctga

DBGET integrated database retrieval system