KEGG   Lachnoclostridium sp. YL32: A4V08_07930Help
Entry
A4V08_07930       CDS       T04430                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
lacy00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lacy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A4V08_07930
Enzymes [BR:lacy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A4V08_07930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Cellulase DUF4838 Glyco_hydro_35 Glyco_hydro_14 Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: ANU45745
UniProt: A0A1C7G0Q7
LinkDB All DBs
Position
complement(1798543..1800492)
Genome map
AA seq 649 aa AA seqDB search
MWLGVDYYPEQWDPALMEADMDTIREMGGNVIRIAEFSWHLMEKVEGQYDFSFFDGVIAK
AKEKGLKVIMGTPTAAIPAWLAKKHPSILSQFENGQKRTFGGRHVYCFNSPEMYEYSEKI
IRALVGHYRGEKQIVAWQIDNEIGHEGSDLCWCPQCQKAFQSFLSEKFGGDIDKLNDTYG
TTFWSQEYNSFEEIPLPAETITTHNPALRLDWERFRSLSICRFMDFQAHLVHEVDPQAVV
MHDFPGGGLDKHVDYSQVAKSLDVVAYNNYPVWGGQKVPIPPHEIAFGLDYIRGLSRKNF
WITEAIMGAQGHDVTGFLPRPNQAKMWSYQGMAHGCNSMMYFRYRGAAKGAEQFCYGVLD
ADNVKGRKFYEVQSFFRDISQYAQAMDAPIHSDVAIVYDYDSLASFRIQRQSILLDCAGE
MKKLYKAFYDGNIPVDVIPAEADLSGYKVVLLPQLIITKPEFRTKAEAFVQNGGTLVLTY
RNAVKDADNNIPAGEIVPVGYTELTGVTVTETESLQDLNAFPVEGQGAFAGSQGFGGIFR
DMLEARDAEVLYRYADTFYTKFAAVTRRKQGAGTVYYLGCALDEGTTAKLMGTILADNQI
ETTPSEDGVEIMIRGSAEQKVRMLINHNDHEVHFQNKTLPPFSCTVELL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtggttaggagttgactactaccctgagcagtgggaccccgccctgatggaggctgac
atggacaccatccgggaaatgggcggaaatgtgatccggatcgctgagttttcctggcat
ctgatggagaaggttgaggggcaatatgacttctccttctttgacggcgtcatcgccaag
gccaaagaaaagggtctgaaggtgatcatgggcacacccaccgctgccatccctgcctgg
ctggcgaaaaagcaccccagtattctctctcaatttgagaacggacagaagcggacgttc
ggcggacgtcacgtctactgctttaacagcccggagatgtatgagtattctgagaaaatc
attcgcgcccttgtgggccattacagaggtgaaaagcagattgtggcctggcagattgac
aacgagatcggccacgaagggagcgatttgtgctggtgtccccaatgccaaaaggcgttt
cagagtttcctgagcgaaaaatttgggggagacattgacaagctgaacgatacttatggc
accaccttctggtctcaggagtacaacagctttgaagaaattcctctccccgctgagacc
atcaccactcacaaccctgccctgcggctggactgggaacggttccgaagtctgagcatt
tgccgtttcatggacttccaggcccacctggtccatgaggtggatccccaagctgtggtc
atgcacgatttccccggcggcggcctggataagcatgtggactactcccaggtggccaag
agcctggatgtcgtagcttacaacaattaccccgtctggggtgggcagaaggtgccgatt
cctccccacgagatcgcctttggtctggactatatccggggtctgagcagaaagaacttc
tggatcaccgaggccattatgggtgcccagggccacgatgttaccggtttccttccccgg
cccaaccaggcaaagatgtggtcttaccagggcatggcccatggatgcaactccatgatg
tacttccgctaccggggagctgccaagggggccgagcagttctgctacggtgtgttggat
gcggacaatgtgaaggggcggaaattctacgaggtccagagcttcttccgggatatcagc
caatatgcccaggccatggacgcccccattcacagtgacgtggccatcgtctatgactat
gactccctggccagcttccgtattcagcgccagagtattctgctggattgcgcaggggag
atgaaaaagctgtataaggccttttatgatggcaatatcccggtggacgttatcccggca
gaggcagatttgtctggctacaaggttgtcttactgccccagctgattattacgaagccg
gagttccggactaaggcggaagctttcgtccagaatggcggcaccctggtcctcacctat
cggaatgcggtgaaagatgccgataacaatatccccgccggtgaaattgtccccgtaggc
tacactgagctgaccggggtaacggttacagaaaccgagagtcttcaggacctgaacgcc
ttccctgtggaaggccagggagcattcgccggcagccagggcttcggcggtatcttccgg
gacatgttggaagcccgggatgctgaggtgctatatcgctacgcggacaccttctacacc
aaatttgccgctgtcactcggagaaagcagggcgcgggaacagtgtactaccttggctgt
gccttagatgagggtaccactgccaagctaatgggtaccatattggccgacaaccagatt
gagacaactccctccgaggacggggtagagattatgatccggggtagtgcggagcagaag
gttcgcatgctcatcaaccataatgaccacgaggtacatttccagaataagacactgcct
cctttcagttgcacagtggagctgctttaa

DBGET integrated database retrieval system