KEGG   Lactobacillus acetotolerans: LBAT_0105Help
Entry
LBAT_0105         CDS       T03976                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lae  Lactobacillus acetotolerans
Pathway
lae00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lae00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LBAT_0105
Enzymes [BR:lae01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LBAT_0105
Transporters [BR:lae02000]
 Other Transporters
  Pores ion channels [TC:1]
   LBAT_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_C GST_N_3 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: BAQ56494
UniProt: A0A0D6A1E8
LinkDB All DBs
Position
complement(107671..108306)
Genome map
AA seq 211 aa AA seqDB search
MKLFYASGASSLAPHILLEESRLQYSVEKVNLDKKTWNGGNYNLINPKSYVPALQTDNGK
VLTECAVILEYIAIKAGNNKFIAKYDSSEYWQQRIWLNYIASELHKNFISPFRKGNWLPN
TKESKKLVYKRVFPRLKFVDQKLNKQNYLVNNTFSAPDTYLFVMTNWLHRLNFGFTNLDN
LKRFDTKMRKRPAVQTILRQEGLPHSLQDES
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattttatgcttctggtgccagctcattagctccacatattttacttgaagaa
agcagattacaatactcagtcgaaaaagttaatttagataaaaaaacatggaacggcgga
aactataacctaataaatcccaagtcctatgtacctgctcttcaaacagataacggaaaa
gttctgactgagtgtgcagttattttagaatacattgccattaaagcaggtaataataaa
tttattgcaaaatatgacagctcagaatattggcagcaaagaatttggttaaattatatc
gccagcgaattacataaaaacttcatctcacccttcagaaaaggaaattggttaccaaat
acaaaagaatcaaaaaaacttgtttataaacgagttttcccaagattaaaatttgttgat
caaaaattaaataaacaaaattatctagtaaataatactttttcagcaccagatacttat
ttatttgtaatgaccaattggttacaccgtctaaactttggatttactaatttagacaat
ttaaaaaggttcgatactaaaatgagaaaacgtcctgcagttcaaacaattttgaggcaa
gaaggattacctcattctttgcaagatgaatcataa

DBGET integrated database retrieval system