KEGG   Lactobacillus amylophilus DSM 20533 = JCM 1125: LA20533_00425Help
Entry
LA20533_00425     CDS       T05031                                 

Definition
(GenBank) hypothetical protein
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
lah  Lactobacillus amylophilus DSM 20533 = JCM 1125
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lah00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LA20533_00425
Enzymes [BR:lah01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LA20533_00425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(77432..80266)
Genome map
AA seq 944 aa AA seqDB search
MADQSQSKRILSKLVKKVVSVTLVLSMFAGIEQAFTITSVNGETIVASSNQQVSMKDGTV
LHAWCWSFNSIKENMAAIKEAGYTSVQTSPINAVVVGNGGDKKFTEQWYYHYQPTAYTIG
NYQLGTEAEFIEMNRVAEQYGIKIIVDAVLNHTTSDYNAISSEVKSIPKWTHGNTLIENW
GSRWDVTQNSLLQLWEWNTQNPEVQQYLLKFLKNAVADGADGFRYDAAKHIELPGEYPSE
FGSNFWNVILNNGSEFQYGEVLQDNISRDADYANLMSITASQYGHSIRDMLRNRNANAGN
LGNYQAGVDPSKLVLWVESHDTYANGKTDSESESAWMSDEDLKLGWAMITARAKGTPLFF
SRPVGGGNGVRFPEQTKLGDAGSNLYKDPTIVAVNKFHNAMVGQSEYIRNPNGDTNVAMI
ERGTQGAVIANLSDSEKSLNTETKLANGTYKDQISGKTYTVSNGRLSGSIARRSVLVLTK
GDDNLASLSVQGYQEGSHTFLTDTLNLTLQTSNTSEATYSVNNGAPIKFENGKVITIGSQ
VQFGETVTVTLSAKNAKGETVQSVYRFTKEDPNANTTIRFENPDKWTDVFVYMYNAKGDK
LLGAWPGTKMEKDGTGLLAITLPISYETDGVKVLFSNNKGAQYPQSLGFEFKSGGTYSKD
GLVAEKPESEFKEENEELPIPFETEYVDNPELKKGQKVTRVEGQDGVKTITYRSEYIGDQ
LVSKTKISETVSKEPVTQVVEVGTKVPDIEQQIANRVYFNNSQGWSKVYTYVYDNKGVPL
VGNWPGKEMSQDEYGYYIELGEEFAGGKVIFNNPDTKVQFPAQNKPGYDLELGQVYEIDG
SHRAVLPEPVAEGFTRITFENPGGWSAANVYAYYGNLIQLPLGAWPGQAMLKDSKGHFYI
DLQEEYANSNVKLLFNKPNSTIQFPVSVGFDFKVDGHYTKDGLK
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcaaagtcaaagtaagagaatactatccaaactggtaaaaaaagtagttagt
gttaccctggttttatccatgtttgctggaattgaacaggcattcacaatcacttcagta
aatggtgaaacaatcgttgccagctccaaccagcaggtttcaatgaaagatgggactgtt
ttgcatgcttggtgttggtcgtttaattctatcaaagaaaatatggcggccattaaagaa
gcaggctatacaagtgttcaaacatccccaattaatgctgtagttgttggaaatggtgga
gataagaaatttacagagcaatggtattatcattatcaaccaaccgcctatacgattggt
aactatcagcttgggactgaagctgaatttatcgagatgaatcgtgtcgcagagcagtat
ggtataaaaattatagttgatgcagtactgaatcatactacttctgattataatgcgatc
tcttcagaagttaaatccattccaaaatggactcatggaaatactttaattgaaaactgg
gggagtcgttgggatgtaactcaaaactctctgcttcagctctgggaatggaatacacaa
aatccagaagtacaacagtatttgttgaaattcttaaaaaatgcagttgctgatggagcg
gatggatttcgttatgatgctgcaaaacatatcgaattaccaggagaatatcctagcgaa
tttggtagtaatttctggaatgttatattaaataatggttctgagttccaatatggtgaa
gtgttacaagacaatatttcacgtgatgcagattatgcgaacttgatgagcattactgca
tcccaatatgggcactctatccgagacatgctccgcaatcgaaatgccaatgctggaaat
cttggcaactaccaagcaggagtagatccatctaaactcgtactttgggtcgaatctcac
gatacatatgcaaacggaaagacggatagtgaatctgaatcagcttggatgagcgatgaa
gatttgaaacttggctgggcaatgattactgcacgcgccaaaggtacacctctattcttc
tcacgtccagttggtggcggtaatggtgtacgtttccctgaacaaactaaactcggtgat
gcgggtagcaatctttataaagaccctacgattgtagcagtaaacaaattccataatgcc
atggttggtcaatcagaatatattcggaacccgaatggtgatacaaacgttgccatgatt
gaacgaggcactcaaggcgcagtaattgcaaacctttccgacagtgagaaaagcttaaat
actgagacaaaattggcgaatggaacctataaagaccaaatttctggtaaaacctacact
gtttcgaacggacgattaagtggttccattgcgagacgatcagtattagtattaacaaaa
ggtgatgataatctagcatccttgtcagttcaaggatatcaagaaggcagccatactttc
ttgacagatacattaaatcttacattacaaacttctaatactagtgaggctacctattct
gtcaataatggcgctccaattaaatttgaaaatggaaaagtcattacaatcggaagtcaa
gtgcaatttggtgaaacagtaacggttacattatctgctaaaaacgctaaaggtgagaca
gttcaatccgtttatcgctttacaaaagaagatccgaatgccaatacaaccattcgcttt
gaaaatccagataaatggacagatgtctttgtatatatgtataatgccaaaggtgataaa
ttgttgggcgcatggccaggaactaagatggaaaaagatggtacaggtcttttagccatc
actcttccaatatcatacgagactgatggcgtaaaagtactcttttctaacaacaaagga
gcacagtatccacaatcccttggttttgaatttaaatcaggcggaacatattctaaagat
ggtttagttgccgaaaaacctgaaagcgagttcaaagaagaaaatgaagagcttccaatt
ccatttgaaacagagtatgtagacaatcctgaacttaaaaaaggacagaaagtaactcgc
gttgaaggtcaagacggagtgaagacaataacttaccgttcagagtacattggtgatcaa
cttgtttctaagacaaaaatcagtgaaacagttagcaaagagccagtaacacaagtagtt
gaagtcggtacaaaagtcccagacatcgagcaacaaattgccaaccgtgtttacttcaac
aattcacaaggttggtctaaggtctacacctatgtttatgataataaaggtgtaccactc
gttggcaattggccaggtaaagaaatgagtcaagatgagtacggatattatattgagctt
ggtgaagaatttgcaggtggtaaagtaattttcaataatcctgatacaaaagttcaattt
ccagctcaaaataaacctggctatgatttggaacttggacaagtctatgaaatagacggt
agccatagagcagttttaccagaaccagttgccgaaggctttacccgtattacctttgaa
aatcctggtggatggagtgctgcaaatgtctatgcctattatggtaatttaattcaactg
cctttgggagcttggcctggtcaagctatgttgaaagatagcaaaggtcacttctatatc
gatttacaagaagaatatgcaaattctaatgtaaaattattatttaataaaccaaattct
actattcaattcccggtttcagttggttttgattttaaagtagatggccattataccaaa
gatggtctaaaataa

DBGET integrated database retrieval system