KEGG   Lactobacillus amylophilus DSM 20533 = JCM 1125: LA20533_07285Help
Entry
LA20533_07285     CDS       T05031                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lah  Lactobacillus amylophilus DSM 20533 = JCM 1125
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lah00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LA20533_07285
Enzymes [BR:lah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LA20533_07285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1386148..1386729
Genome map
AA seq 193 aa AA seqDB search
MAQLFFRYGTMNSGKSIEILKVAHNYEEQNKTIILMTSAVDTRTGVGIVSSRIGLQRDAI
PVATETNIFDLVQETDPNAACVLIDEAQFLNRKHILQCARIVDEMNIPVMAFGLKNDFRN
HLFEGSESLLLYADKIEELKTICWFCRRKATMNLRVHEGQPVYEGKQVQVGGNESYYPVC
RQHYFHPNLAQKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcccaattatttttccgctacgggacgatgaatagtggtaaaagcatcgaaattttg
aaggttgcgcataactatgaggagcagaacaaaacaatcatcctcatgaccagtgcggtg
gatacgagaacgggtgtgggtattgtgagctcgcggattggcctgcaaagagacgcgatt
ccggtggctaccgaaactaatatctttgatctggttcaagaaactgatccaaatgccgcc
tgtgtcttgatcgatgaggcacagttcttgaataggaagcatatcttacagtgtgctaga
attgtggatgaaatgaacattccggtgatggcgtttgggctgaagaacgattttaggaat
cacctgtttgagggcagtgagtccctgttactctatgccgacaaaatcgaagagttgaag
actatttgttggttctgtcggcgaaaggcgacgatgaatctgcgtgtgcacgagggccaa
ccggtttatgagggcaagcaggtccaagtcggtggtaatgaatcatactatccagtttgt
cgccaacactattttcaccctaatctagctcagaaaggataa

DBGET integrated database retrieval system