KEGG   Leptospira alstonii: A0128_00145Help
Entry
A0128_00145       CDS       T04558                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
laj  Leptospira alstonii
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:laj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A0128_00145
Enzymes [BR:laj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A0128_00145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(29621..31597)
Genome map
AA seq 658 aa AA seqDB search
MIFGADYYPEQWTQKDWEEDIRIMKEMGISSVRLAEFGWALMEPKEGKYDFSFFNKILNL
IHKNGMTAILGTPTATFPPWLVKKFPDIIQERDGVKRTIGTRRQACFSSPDYRKASVKIV
TAMAKHFGNHPAVIGWQIDNEIGHEGSDIDHSPVSLKAFRVWLKNKYKTIQNLNETWGNV
FWGVLYNSFDEIPIPGVHVASNFHPSMIQDFYRFHSDTIIDFVKLQAQILRKFSVGRPLT
TNLYPSPFLPIIDMAELASYLDYISWDNYPTWGEQEEPFPHPFIAAMQQYNRGLKNLPFT
VMEQISGFQGHDLLGYLPAPGQTKLWMKHSIVHGSNAIYFFRYRTARFGQEQLCYGILDH
DKEKTERYFELQKGIKEISEYADDFVEELFPAQVAVVHDIENARNWKHQPISSGLKYSPV
PWAQLGYDVEMATWFSGMNVLNVNTHFRPASKIDFKDYKIIILPMYTMVTDSIFQKLERF
VKEGGTLILGYRTGAKDLNGWMYDSQVPGPFSEMAGVKVRKFEAVGNQKVKFKFRFFPGT
CSKICEILEPTTAEVWARYTDKKKFYKGQPIITANSYHKGRVIYIGASLEPLSFMLLYRR
ILREAKIPFTFYGPTVEKLNRTGRNQNYEIFINHSGKKNLAGLKILNPYEVRITPKKK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgatattcggcgcagactactacccggaacaatggactcaaaaagattgggaagaggac
attcggatcatgaaggagatgggtatttcttcggttcgactcgccgaattcggttgggcg
ctcatggagcccaaagaaggaaaatacgacttttccttctttaacaaaattctaaatctc
attcataagaatgggatgaccgcgattctgggaactccgacagccacttttcctccatgg
ttagtaaagaaatttccagacataattcaagaacgagacggagtcaaaagaacaatagga
accagaagacaagcctgtttctcatctcccgattacagaaaagcgtcggtaaaaattgtg
accgcaatggcaaaacattttggaaatcatcccgctgtgattggatggcaaatcgacaac
gaaatcggccacgaaggttccgatatcgatcattcgcccgtttccttaaaagcatttaga
gtttggttaaagaataaatacaagacgattcaaaatctaaacgagacttggggaaatgtt
ttttggggagtcctttataattcctttgatgaaattccgatcccaggtgtgcacgtagcg
agcaactttcatccttcgatgatccaagacttctatcgttttcattcggatacgatcatt
gattttgtaaaactccaagctcagattttaagaaaattctccgttgggagacctcttacc
accaatctttatccttctccttttcttccgatcatcgatatggcggaactcgcttcttac
ttggattatatttcttgggataactatcctacttggggagaacaagaagaacccttccca
catccttttatagcggcgatgcaacaatacaatcggggtttgaagaatcttcctttcaca
gtaatggaacaaatttccggatttcaaggacatgatctcttgggatatctcccggcgccc
gggcaaaccaaactatggatgaaacattccatcgttcacggatccaatgcgatctacttt
tttcgttatagaaccgcacgttttggtcaggaacaactttgttatggaatcttagatcat
gataaagaaaagaccgagcgctatttcgaactgcaaaaaggaatcaaagaaataagcgaa
tatgccgacgactttgttgaggaattattcccggcgcaagttgcagtggttcacgacatc
gagaatgcgagaaactggaagcaccaaccgatttccagcggactcaaatactcaccggtt
ccttgggcacaacttggatatgacgttgaaatggcgacctggttttcaggaatgaacgtt
ctcaacgtaaacactcactttcgtcccgcttctaaaatcgattttaaagattataaaata
atcatattaccgatgtatacgatggtaaccgattccatttttcagaaactcgaaagattt
gtgaaagaaggaggaacacttatcttaggatatcgaaccggggctaaagatttaaacggc
tggatgtatgattctcaagtgccgggaccgttttcggaaatggccggagtgaaagttcga
aagttcgaagcggttggaaatcaaaaagtaaaattcaaattccgttttttcccaggcact
tgttctaagatatgcgaaattttagagccgactaccgccgaggtttgggcccggtacacc
gataagaaaaaattctacaaggggcagcctataattacagcaaattcttatcataaagga
agagtaatttatatcggagcctctttagaacctttgagttttatgcttctctatcgtcgt
attttaagagaagcaaagattccttttacgttttacggaccgaccgtggaaaaattaaac
cgaactggaagaaatcagaattacgaaatctttatcaatcattccggcaaaaagaattta
gctggtctgaaaattttgaatccgtatgaagttagaattacacctaaaaagaaatga

DBGET integrated database retrieval system