KEGG   Lingula anatina: 106152150Help
Entry
106152150         CDS       T04921                                 

Definition
(RefSeq) uncharacterized protein LOC106152150
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
lak  Lingula anatina
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lak00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106152150
Enzymes [BR:lak01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106152150
Chromosome [BR:lak03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106152150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 3252 aa AA seqDB search
MDFYDPESPTQDVDSPALSPKPTVEEGDEEDISHSVSSTAEDAVSWRKCAKDEDSHLMGE
GGEENEKKQITALTEQVKEAAEVTEQLLKMETSPPLNHMVDKTETGHTSFDEQNDKNSSF
RKKTHLIDTQDFTNDDHDFPTFDSTEMPPVIPDIQKLNENATDASISLNSEGKQQDSILC
PHSDTSITETPSSMEIPIPDQAVSQPLTQKPDEYCLDNIPIPGGQPTLSPAAHIPLPPMP
KPSQAESPENSTPRAGKKKKKKKKKKLDIESPDTVPSGVDLLTLLPPGHPQFPKFHEEPQ
EQLMEFHSGHSGFPGGPSLESKYFNPGTQRPGFKGPLLPTPQPHFPTPMEAQYPGQQLPY
YARLPGVHNHPPYPGASLPPDQQHFMPGSYGGVMPGVIPQAYGSSVTTDQTQVMMAPDLS
APQYTSLQTTPAPPLPPAQPKSKKANKIPALPSPSSIPLPSQPPPPEQPPPPPHPPPPAQ
SSAPSETKEDNTKSVQSDITDLKEDVEKHNQSPEKAQTVTKTEAVAPSAVPEAPKGPKSK
INMLIQSKMSKLNLQTEKEISAPPLSVNSGVKPAANAVKPKVLKFQIKTVKKLKVFEDDS
DDEEQDQKSEKIPIKPDQDLENIPAISSIMSPIMAAKRAAALVNKEIQSQLDVPGDKDMD
VTTNKAKHVSFKDTSLQAQDEIQMVSADLEASDSSEKPRTIKVEAESLPESSFGSDINVL
TEQVNSQKECQSLSTEHVTPKEDKEEKTKSQSPGRKRRSLSPAERRKSPSPSSGRHKSPS
PVGRNRSTSPARSRRRSSSPGRRKRSPSPSSGRRSPSPSGGRRRSRSPSGRRQRSTSVER
RRRSPSGGRRRRSPSPPRSRRRSPRRISPVRSRRRSPSPSRRRRSPSPSKSRRSQSPVRV
RRRSPSPTNARRRSPSPGDSRRRSPSPIGRRRRSPPITGGQQRPSSPTVTHTRSVTPENV
RKRSNSPSPARGTSPVSSEAKQISPVERHKSPLSPVNRKRSPSPANERRRNLGSNRHRDT
SPERTRHRDDRSRYRRESDRSRYRDDRYRPRDDRRRSRDEYSRHDKYSSRDDDRRDSAKS
RECDERNKNQGDLLHKQHFVDQAPYTGENEGEVTGNDPSGIAHDMYAAPYKQNEPVFLQN
QNTPQNVARTVIEPAGGFQSSVRTTSRSSIEPVIEKVMTALPNVPSYPHFPGQYVQKVPQ
VTSSSAMGVMQIPLPPPAPGPPIPKPSSILNTGTAPSLFLPGTVQPSHSFPSASSSGIPI
TRSLQMEVVPAALPVKVSTVTSALPVGAAPLVGPLPDLDSIPLPAATSTTSNAPQSESSE
TICDTNTQQKSPTSPEPVLVTSFVDKKKVVLENGEGEIPPPPATAPKKKTVTFSEQNDEY
EIPPPPPIIEDEYVYNQDSDEDEDDDVPPPPPPPPPPPPPRPKVVAEEEEEEEEDDIPPP
PPPPPPPPPKEKTNPEELSLPPLSEDLSTEEVEPSTVWGKKHDIPAPPPPADPLSSSYDE
QEVSGSQDGLTWGKKLPTAAPQRPWSPVQNPEVQSSQGDYDIGEIDMDIDSDSESNSAPQ
ESGIDMDISSPEQEFHQTDLSKSLLQPPPPPPPPPAPTNDQPDEQPTSSIGKEALADISL
PVSHLPAPSATVPQAQEPTQPSPFRLSFRAQKQKLTLSDLWEDDTEVKKLSALPKAPLSP
DASLELERKDQDDINSSKTAVKESVYVAEQQSLSQSHHSVQDISTQPNTVDKDIGDNSEI
KKLLDKSTPAEVQNFKHELAQRWAPVTFSTPPEETATENKSVTEDNAEDTKTREVIGSKG
KKRKTRWSDAIEVDTDDSNSDAGTPQRRRSNRIRSIEEKIKQEKEEKDRRDKEEWERKER
ERKAMEQIRLAKLEKEKITKGTVDEENGEERPTILSLIKQVSSSEARDVHIPLPGRKEPF
DAVSALKAEDGIRKEEMMSPNVKPKSRWRWISEVENNEVSSLVNSSSATQSTTDSNIHEG
TTLIPPPPSSPSRETASVVKQELVDGIAIDNTDSSSITSDSSFKVPVLKLERIENDPRFK
DLDVSPSKDLEKREPSPEKVTPPVYEKITENVYLSERKKSKASKEVRRMVCDCTTSKEDR
MYGMAACGEDCLNRMLMIECGSRCPCGDYCTNKRFQRFQYSNVAPFQTDWKGWGLKANED
LTKGQFVMEYIGEVLGYKQFKARTKQYAREGHAHHYFMALNADEIIDATVKGNDSRFINH
SCDPNCETQKWTVNGQLRVGFFTRQQIPKGTELTFDYQFEVYGQEAQKCYCGSSNCRGVL
GVQKKQTEAQKLALENKKREKKRKKELFDDILLEEEIERMQEWHGLKNHKHVLELCRVMV
RAETTSQKLALLQIMQETKEPACHRLFLGYHGLSLLWSWMADIGDGSLELKKQILTVLKL
LPITNKTVLEDSKVLSVVQKWAVELKNNEEKPDGSDFGVDKDVDEECASEPPSRSETPLI
SSSSHLDSLRLSEQYKSDSDDALQKTPNKKRILQRVKEQDEINSGSDSELSESSRHSTIN
ALDISVNSTISTLDSSLATSRLSASLNTLQESYNSTMASSQDSEQLLGFRGVAKDEEKEM
LDAELKVLEENSDISQDQASAGDEICPPDQGQSQDTKKDSDVEQEEDVPGDGPSIQDEAE
FESIVDTVVDEENPSAPAPCGEGDVAADEEPSLSEEGLDAQKTIGVAEQDSSSQDSIQAD
TTQGEQQTESTVNQEEPSLADFASELLESWSNLKELFRIPKKQEVEERKQTERELDQRDK
ERYRDRRDSYERDRDRGRDKRYDKDRDSDYYRDRSRERDYDRKRRYDDSPDRDRTKRRRK
TDDDDKPRKPLLPTPPKMSKEERRQLFEAQVRAQDEMTRQQEEALQQEAIQQAMQYQYYD
QYGVPVTVDANGIPYVQDPNIIAGAAPELLGVDPNQQYGDPSAAFISSQYEQQTAPQGAQ
FLDSNRPVIPQYLEQVPMSAQPQYIDPTQPQVIYQPTQQPAQYQVQPQYIQTPSGYVQVA
AGSPAPQYLPQQQPVYYVSASHSGVVVQQPYGQVNQPVVSTQTGLQQVPLQHPLQVQPQP
LQAVEADIEEDTLPPPAPPPPKQKLPPNWKTAKDPEGKTYYYHTGTRQTQWDPPTWEGAE
QDEMDLGTPTHDEPRIKAKKKTTTAAADTSSEVAKRCKEAFRGKMSQYIVTCLNPFRRPD
CKLGKITNTDDFKHLARKLTHHIMTKELKHCKHPEDLEVNENVKSKAKDYIKKYMSKFGQ
IYKRDPASPTIK
NT seq 9759 nt NT seq  +upstreamnt  +downstreamnt
atggatttctatgatccggagagtccgacgcaggatgtggattcgcctgctctctcgcct
aaaccaacagtagaagaaggggatgaggaggatatttcacattcagtgtcttcaactgca
gaagatgcagtctcatggcgcaagtgtgccaaagatgaagacagtcatttaatgggagaa
ggaggggaggaaaatgaaaagaagcaaatcacagccttgacagaacaagtgaaggaggct
gccgaagtcacagagcaactgcttaagatggagacatcaccaccccttaatcatatggtg
gataaaacagaaactgggcataccagttttgatgaacaaaatgacaaaaatagttcattt
agaaaaaaaactcacttaattgacacgcaggattttacaaatgacgatcatgactttccc
acatttgactcaacagaaatgccacctgtgataccagatatacaaaaattaaatgaaaat
gcaactgatgcctcaatttcattgaacagtgaaggaaagcagcaagattctattttatgc
cctcattctgatacatccatcaccgagacaccctcttcaatggagattcccatccctgac
caggccgtttctcaacctctgacacagaaaccagatgaatattgcttagacaatataccc
ataccgggtgggcagcccactttaagtccagcagcacacatacctctacctccaatgccc
aaaccaagtcaggcagaatctccagagaatagtacccctagagctggtaaaaagaaaaag
aagaagaaaaagaaaaaattggatattgaaagtccagatactgttccatctggtgtggac
ctactgacacttttaccaccagggcatccccagtttcctaagtttcatgaggaacctcaa
gagcaacttatggaatttcattcagggcattcaggttttcctggtggaccctcattagaa
tccaaatatttcaacccaggtacacaacgccctggcttcaaagggccactactgccaaca
ccacaacctcattttccgacaccaatggaagctcaatatccaggacagcagttgccatat
tatgctagattacctggtgttcacaatcatcctccatatcctggagcctcactgcctcct
gatcagcaacattttatgccagggtcttatgggggtgttatgcctggtgtcatcccacag
gcatatggtagcagtgttacaactgatcagactcaagttatgatggcaccggatctgtca
gcacctcagtacacgtctctacaaacgactccagccccaccactgccaccagcgcagcca
aaatcaaagaaagcaaacaagataccagctctgccctcaccatctagcatcccactgccc
agtcagcctccacctccagaacagccacctccacctccacaccctccaccaccagcacag
tcttcagcacccagtgaaaccaaagaggacaatacaaagtcagtgcaatctgatattaca
gacctaaaagaagatgtagaaaaacataaccagtctccagaaaaggcacaaactgtgaca
aaaactgaagctgtggcaccctctgctgtaccagaggcccccaagggtccaaaaagtaaa
ataaacatgttgattcagagtaaaatgtctaaacttaacttacagacagagaaagagata
tcagcaccacctttgtcagttaactctggtgtgaagcctgcagcaaatgctgttaaaccc
aaagtgttgaaatttcagataaagactgttaaaaaattgaaagtttttgaggatgattcc
gatgatgaggaacaggatcagaaatctgagaaaattccgataaaaccagatcaagattta
gaaaatattccagccatcagttcaattatgtcacctataatggctgctaaaagggcagct
gctttagtcaataaagaaattcagtctcagcttgatgttcctggtgacaaagacatggat
gtgaccacaaataaggcaaagcatgtatcatttaaagatacttctttgcaagctcaggat
gagattcaaatggtttctgctgacttggaggccagtgattcatctgagaaaccaagaact
ataaaagtggaagctgaatcgttacctgaatccagttttggctctgacattaatgttctg
acagaacaggttaacagccagaaggaatgtcagtctttgagtacagagcatgttactcct
aaagaggataaagaagaaaaaacaaagtcacaatcacctgggagaaaacgaagatcattg
tcaccagcagaacgaaggaagtctccatctccatcaagtggcaggcacaagtcgccttcc
cctgttggcagaaataggtcaacatcacctgcaagaagtaggcgcaggtcatcatcacct
ggcagaaggaaaagatctccatctccatctagtggaagaaggtccccatcaccttcagga
ggtagaaggaggtcacggtcaccttcaggaaggaggcaaaggtcaacatcagttgaaagg
agacgaaggtcaccttcaggtggtaggagaagaaggtccccttcccctcctaggtcacgc
cgtagatctccacgaagaatatctccagtgaggtctcgcagaaggtcaccatcacctagc
aggcgaaggagatcaccatcgccttccaagtcgagaagatctcaatcacctgtccgtgta
agaaggagatcaccatctcctaccaatgctaggcgcagatcaccttcacctggagattcc
aggcgaagatctccatcacccattggtagaaggcgaaggtcaccacccatcactggtggg
cagcaaaggccatcctctcccactgtaactcatactagatctgtaactcctgaaaatgtg
agaaaaaggtcaaattcaccatcacctgccagaggcacatcacctgtctcttctgaagct
aaacagatttctcctgttgaacgccataaatcacccttgtccccagttaatagaaaacgg
tcaccttcaccagcaaatgagaggcgtcgaaatttaggtagtaatagacatagagacacc
tctcctgaaagaactcggcacagggatgacaggtcaagatacagaagagagagtgacagg
tcgcgatatcgggatgacagatatagaccgagagatgatagaaggcggtctagagatgaa
tatagcaggcatgataaatacagcagcagggatgatgatcgtagagacagtgcaaaaagt
agggaatgtgatgagagaaataagaaccaaggagatttattacataaacagcattttgtt
gaccaagctccttacactggggaaaatgaaggagaagtaacagggaatgaccccagtgga
attgcccatgacatgtatgcagcaccttataaacagaatgaacctgtttttcttcaaaac
caaaatactccacaaaatgttgccagaactgtaattgaacctgctggtggtttccagagt
tctgttagaacaacatccaggtcaagcatagaaccagtcatagagaaagtaatgacagcc
ctaccaaatgttccttcttatcctcattttccaggacaatatgtgcaaaaagtgccccag
gttactagtagcagtgcaatgggtgtaatgcagattccattaccaccgccagctcctggt
cctcctataccaaaaccatcctccattcttaatacagggacagcaccttccttatttctt
cctggtactgttcaaccatcccactcctttccttctgcatcatcgtcagggattccaata
acaagatcactgcagatggaagttgtgccagcagcattacctgtaaaggtttctacagtt
acttcagcattacctgtaggagcagctcctttagtagggcctttgccggacttggacagc
atacccctgcctgctgccacaagcacaacctccaatgcccctcagtctgaatccagtgaa
actatttgtgacacaaatactcagcaaaaatcaccaacaagtccagaaccagtgctggtt
acatcatttgttgataaaaagaaggtagtactagaaaatggagaaggagaaataccccct
cctcccgctacagctccaaagaaaaagactgttactttttcagaacagaatgatgaatac
gagatcccacctccaccacctattattgaggatgaatatgtgtacaaccaggacagcgat
gaggatgaggatgatgatgtgcctccccctccaccacctccacctccacctcctcctcct
cggcctaaagtggttgcagaagaggaggaggaggaggaagaagatgatattccacctcca
cccccacccccacctcctccccctccaaaggagaaaacaaatcctgaagaattatccctg
ccaccgttgagtgaagatttatctactgaggaagtggaaccaagcactgtgtggggtaag
aagcatgacattccagctccccctccaccagcagaccccctttccagtagctacgatgag
caagaagtgagtgggtctcaggatggtctcacctggggaaagaagctcccaactgctgca
ccccaaaggccctggagtccagttcaaaacccagaggttcagtcctcccagggggattat
gacattggtgagatagacatggacatcgattctgacagcgaaagcaacagtgcccctcag
gagtctggtatagatatggacatcagttctcctgaacaggaattccaccagactgatttg
agcaaatctcttctccagccaccaccaccaccacctccaccaccagctccaactaatgat
caacctgacgaacagccaacctcatctattggcaaggaagccttagcggatatctctctg
cctgttagtcatttaccagccccgtcagctactgtgccccaggctcaagaacctacacag
ccatcacctttcagattatcttttagggcacaaaaacaaaaacttacactgagtgatctg
tgggaagatgacacagaggtgaaaaaattgtctgctctgccaaaagcccctctgtcaccg
gatgcatcacttgaattagaaagaaaggatcaagatgatatcaattcttctaaaactgca
gtcaaagagtcagtttatgtagctgaacagcagtctctctcccagtcacatcactctgtt
caggatattagtacacaacctaatacagttgataaagatattggggataacagtgagatt
aagaagcttcttgacaagtcaaccccagcagaagtgcaaaattttaaacatgagctggca
caaagatgggcacctgtaacatttagcacacctccagaagaaactgctacggagaataag
tctgtcacagaggacaatgcagaggacaccaaaacaagagaagtcatcggatcaaaaggg
aaaaagagaaagacaagatggtctgatgcaatagaagtggacacagatgattcaaattct
gatgcaggaactccacagagaaggcgcagtaataggatcaggtctattgaagaaaaaata
aaacaggagaaagaagaaaaggatcgaagggataaggaagaatgggagaggaaggaaagg
gaaagaaaagcaatggaacaaataaggcttgcaaaacttgagaaagaaaaaatcacaaaa
ggaactgtagatgaagaaaacggagaagaaaggccaacaattttaagtttaattaagcag
gtttcctcctcagaagctagagatgtacacatccctctgcctgggcgaaaagaaccattt
gacgctgtatcagctctgaaagcagaagatggaattcggaaagaagagatgatgtcccca
aatgttaagcccaagtcaagatggcgttggatcagtgaggtggagaataacgaagtctcc
agtttggttaattctagtagtgccacacagtccactacagactctaatatccatgagggt
acaactctgatcccacccccaccgtcatcaccctcacgagagactgcttcagtggtgaaa
caggagcttgttgatggtattgctatagacaatacagattccagcagtataacttcagat
agttcatttaaagtgccagtgttgaaactggagagaattgaaaatgaccccaggttcaag
gacttggatgtgtctccaagcaaagatcttgagaaaagagaacctagtccagaaaaagta
accccaccagtttatgagaaaataacagagaatgtttacttgtcagagagaaagaagtcc
aaagcatctaaggaggtccggcgtatggtatgtgattgtacaacctccaaggaagaccgt
atgtatggtatggcagcttgtggagaagactgccttaacagaatgctcatgattgaatgt
ggttccagatgcccatgtggagattactgcacaaataagagatttcaaaggtttcagtat
tccaatgtagcaccattccagacagattggaaaggctggggtctcaaggccaatgaagat
ttaacaaaaggccaatttgtcatggagtatataggggaggtgttgggatacaagcaattt
aaggcccgcacaaagcagtatgcaagagaaggtcacgcccatcactattttatggccctg
aatgcagatgaaataatagatgctactgttaaaggaaatgattctagattcatcaaccac
agttgtgatcccaattgtgaaacacagaagtggacagtgaatggacagttgagggttgga
ttctttacaagacaacagattcccaaggggacggaactcacttttgactaccagtttgag
gtgtacggtcaagaagcacagaagtgttactgtggttcctctaactgccgtggtgtcttg
ggtgtacaaaagaaacagacggaagcacagaaacttgcattggaaaataagaaaagggaa
aagaagaggaaaaaagaattatttgatgacattttgttggaggaagaaattgagcgcatg
caggagtggcatggtctgaagaatcacaagcatgtgttagagttgtgccgagtaatggtg
agggcagaaaccactagtcaaaagctggctctgttacagataatgcaggaaacaaaagaa
ccagcatgccatcgcctgtttcttggctaccatgggctgtcactgttgtggagctggatg
gcagacattggggatgggtccctggaactgaagaaacaaatcctcactgtgctcaagttg
ttgcccatcactaataaaactgtgcttgaggacagcaaagtgctttcagtggtacaaaaa
tgggctgtggaacttaaaaacaacgaggagaagccagatggtagtgactttggtgtagat
aaagatgtagatgaagaatgtgcaagtgagccgccatcacgttctgagactccgctcatt
agtagcagcagccatcttgatagtctgcgcttatcagaacagtataagagtgacagcgat
gatgctctacaaaagacaccaaacaaaaagagaatattgcagagagtgaaagaacaagat
gaaatcaacagtggctctgacagtgagttgtcagagtctagtagacattctactataaat
gcattggacatatcagttaacagcacaattagcacattagacagctctttagcaacaagc
aggctctcagctagtttaaatacactacaagaatcctacaattcaacaatggcatcctca
caggactccgaacagttgctgggttttcgtggggttgcaaaagatgaagaaaaagagatg
ctggatgcagagctaaaggttttagaagaaaactctgacatcagccaagatcaggcatcg
gcaggtgatgaaatttgcccaccagaccaaggtcagtcccaggatacaaagaaagacagt
gatgttgaacaggaggaggatgttcctggtgatggtccatccatacaagatgaggcagaa
tttgaaagtattgttgacactgtagtggatgaagaaaatccaagtgcccctgctccttgt
ggggaaggtgatgtggctgcagatgaggaaccatccttatctgaggagggtctggatgcc
caaaaaactataggagttgcagaacaagattcatcttcacaagactctatccaggctgat
acaacacaaggagaacagcaaacagaatcaacagtaaatcaagaagaaccctcgctagca
gactttgcatccgaattgctggagtcctggagtaatctcaaggaattatttagaatcccc
aaaaaacaggaggttgaagaaagaaaacaaactgaaagagagctggatcaaagagataag
gaaagatacagggatcgaagggacagctacgagagggaccgtgatcgtggacgagacaaa
agatacgacaaggatcgagacagtgactattacagggataggagcagagaaagagattat
gacagaaagagacgctatgatgattcacctgacagagatcgtacaaaacgaagacgaaaa
acagatgatgatgataaacctaggaaaccattgctgcccacaccacctaaaatgtccaaa
gaagagcgccgtcagctgtttgaggctcaggtgcgtgctcaagatgagatgacaagacaa
caggaagaagccctccagcaggaggccatacagcaagcaatgcagtatcagtattatgac
cagtatggggtgcctgttacagtggatgctaatggtataccttatgttcaagacccaaac
atcatcgcaggtgctgcccctgaattgctaggtgtagaccccaatcagcagtatggtgat
ccttcagcagccttcattagctctcagtatgaacagcaaacagcacctcagggagcacag
ttcttagactcaaaccgtcctgtcatcccacaatacttggagcaagtgccaatgtcagcc
cagccacagtatattgaccccactcagccccaggtcatctaccagcccacacagcagcct
gcacagtatcaggttcagcctcagtatatccagacccccagtggttatgtgcaggtggca
gctggaagcccagccccgcagtatttaccccagcagcagccagtgtattatgtgtctgcc
tcacactctggtgtggtagtacagcaaccttatggccaggtcaatcaacctgtggtctcc
actcagacaggattacagcaggtccccttgcagcacccattgcaagtccagccgcagccc
ctccaggccgtggaggcagatattgaggaggatacccttcctccacctgctccaccccca
ccaaaacagaaattacctcctaactggaagactgccaaagacccagagggcaagacttac
tattaccatactggaacaagacaaacccagtgggatccaccaacctgggagggagccgag
caggatgaaatggacctgggtacgcccacacatgatgagccaaggatcaaggccaagaag
aagaccacaactgctgctgctgacacttcaagtgaggttgctaaaagatgcaaggaagcc
tttaggggaaagatgtcccagtacattgtgacatgtttgaatccctttaggaggccagac
tgtaaacttggtaaaatcaccaatactgatgattttaaacacctggccagaaagctcact
catcacataatgaccaaagaattgaagcactgtaagcacccagaagatttggaggtcaat
gagaatgtcaaatctaaagccaaagactacatcaaaaagtacatgtccaagtttgggcaa
atatacaaacgtgatccagcttctcccactatcaaataa

DBGET integrated database retrieval system