KEGG   Lingula anatina: 106152364Help
Entry
106152364         CDS       T04921                                 

Definition
(RefSeq) annulin-like isoform X1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
lak  Lingula anatina
Brite
Enzymes [BR:lak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     106152364
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 791 aa AA seqDB search
MTRYRSECWIYMYGDYSMSRRGFSRGRRMVTYESRMGSAFDPVSIPHFWQAYGSTADGRS
VDRWKAQHERSSVKIDDNTVMRCNWVDLKIAQNSKDHHTDQFECSSYWEDDKYQRQDPYL
ILRRGQAFVVDLQMDKPFNKEMHDLKLCFEYGKFPKPGKGTSVSFHVSAKDRPKEWGAEI
VSVVGNTITVSIITPPDCLIGKWDMRVDTAVKLNDGSTRLFRYFFPKQFYVLFNPWCKDD
QVYMPDTKLLNEYVLNDVGKIYAGTSKQIGSKPWNFGQFEDFVLDCSLLVLEKSGLALSA
RGNPVQIARKISAFTNSPDDNGILMGNWSGNYEGGTRPTKWVGSVAILQEYWKRKRPVKY
GQCWVFSGVVTTICRCLGIPCRPVTNFASAHDSDGSISIDDYFDMDGNLLEEFCEDSIWN
FHVWNDVWMARPDLPSGCGGWQAIDATPQELSDGVYCAGPCSLNAIKAGQVYLPYDGPFI
FAEVNADRVRHRRRNDGTWDRYFMKASVGQKISTKKPLVTAVDSFSRWKKEDPDREDITE
QYKFKEGTSEERAATLAANLKSTRRDLYDRNTDGDDVKFEWEDKDFITVGSSFDVALVMT
NKAKEERKVEITLKAAVVYYTGVIKSFVKGDKFEIVLAAGEKGKKVTMSVTPDDYLDELV
DHANFKTTVIAKVDETNQIFMEDDDFMLRPPPLEFEFLGKKNEIKTLTPFKLKVGFTNPL
PIPLTRCMFIVEGPGLQKPMEYQLMDVGPGKRAEQTISLTPKTAGNKQVIVSFDCYQPCD
VTGMFPVTVKG
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgacacgatatcgtagcgagtgttggatatatatgtacggagattacagcatgtcgcgt
cgtggtttttctcgaggtcggcgcatggtgacgtatgaaagtcgcatgggaagtgccttc
gatccagtgtcaattccccatttctggcaggcatatggcagcactgctgatggtcgttca
gtggaccgatggaaggcacaacatgaaagatccagtgtgaaaatcgatgacaacacagtg
atgagatgtaactgggttgacctgaaaattgcccaaaattctaaggaccatcacaccgac
cagtttgagtgttcttcctattgggaggatgataaatatcagcgccaggatccatacctc
atcttgaggagaggacaggcatttgtggtggatctccaaatggacaaaccttttaataaa
gaaatgcatgatttgaagctgtgttttgagtatgggaaattccccaagccaggcaaaggc
accagtgtcagtttccatgtgtctgctaaagaccgccctaaggaatggggagccgagatt
gtgtctgtggtgggaaataccatcaccgttagcatcatcacccctccggactgcctgata
ggcaagtgggacatgagggtggacacggctgtcaaactgaacgacggatcaacgagactg
ttccgatatttcttccccaaacaattctatgtgctgttcaacccatggtgcaaagatgac
caagtctatatgccagataccaagctcttgaatgagtatgtcctgaatgatgttgggaag
atatatgctggtacttccaagcaaattggttctaaaccctggaactttgggcagtttgaa
gattttgtcttagactgcagccttttagtgttggaaaaatctggattggctctcagtgct
agaggcaatcccgtgcagattgcaaggaagatttctgcctttacgaactcccctgatgac
aatggcatcttgatgggaaattggtcgggtaactacgagggtggcaccaggccaacaaag
tgggtcggcagcgttgccattctgcaagaatactggaagaggaagaggccagtcaaatat
ggacagtgctgggttttctcaggagttgtcacaacaatttgccgctgccttggcatccca
tgccgacctgtgaccaattttgcctctgctcatgacagtgatggcagcatcagtattgat
gactactttgatatggatggaaatctcctggaagaattctgcgaagactctatatggaat
ttccatgtttggaatgacgtatggatggctcgcccagatttaccctctggatgtgggggc
tggcaggccattgatgctacaccacaagaacttagcgatggtgtgtactgtgcaggccct
tgttccctgaatgctatcaaggcaggtcaggtgtacctgccttatgatgggccgttcatc
tttgctgaagtcaacgccgacagggtcagacaccgaagacggaatgatgggacctgggat
agatatttcatgaaagcaagtgttggtcagaaaataagcaccaaaaaacccctggtgact
gccgtggactccttctcaagatggaaaaaggaggatccagatagagaggatatcactgaa
cagtataagtttaaagaaggtacttctgaggaaagagctgccaccttggctgccaacttg
aagtccacccgacgtgacttgtatgacagaaatacagatggggatgatgttaaatttgag
tgggaggataaagatttcatcactgttgggagttcctttgatgtggctctggtaatgacc
aataaggcaaaggaagagcgcaaagtagagattaccttgaaagccgcagtggtctactat
actggagtcataaaaagtttcgtgaagggtgacaagtttgaaatcgtactggcagctgga
gagaaaggcaagaaggtaactatgagcgtaaccccagatgactacttggatgagcttgtg
gaccatgctaatttcaagaccacggtgattgccaaagtggatgagacaaatcagatcttt
atggaggatgacgacttcatgctcagaccaccaccgctagagtttgaatttttggggaaa
aagaatgaaataaagactctgacccccttcaagctgaaggtaggctttaccaatccacta
ccgatccccctcaccaggtgcatgtttattgtggaaggacctggactccaaaaacccatg
gagtatcaattaatggatgttggtcctggtaagagagccgagcagactatctcgctgact
ccaaagactgcaggaaacaagcaagtcattgtcagctttgactgctaccagccatgtgac
gtcactggaatgttccctgtcaccgtcaaaggatag

DBGET integrated database retrieval system