KEGG   Lingula anatina: 106162221Help
Entry
106162221         CDS       T04921                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like isoform X1
Organism
lak  Lingula anatina
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 261 aa AA seqDB search
MWLGGSKQLPFLQGKARSVLDLDTHKFHGSALPPLTPGRLRLYSMKFCPFAQRTRLVLVH
KNIPHEVINVNLKHKPKWLFEKNPKGLVPILEQDNRIVFESLICDEYLEDMYPEKPLRPS
DPYIKARQNILEGYFEQVLRSLYSTMFTRNPEKKLRGRENLLKSLEIYETELEGKFYGGD
EVGMLDFHLWPWIERIYTISHITGLEFSVEKFPKMNAWIQRMYQTPAVKATALPGEVHAA
FLKSLMDRSPNYEIEVPASRL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtggctagggggttccaaacaactgccctttttgcagggaaaagctaggtctgtcctt
gatctagatacacacaagtttcatggctcagcattacctccactgactccaggaagactg
aggctgtatagtatgaaattttgcccctttgcacagcgaacaagactggttctggtacat
aagaacatcccccatgaagtgattaatgtcaacttgaagcacaaacccaagtggttgttt
gaaaagaatccaaaaggactggtgccaatactggagcaagacaacaggattgtgttcgag
tctttgatatgtgatgaatacctagaggacatgtacccagagaagcctctcagacccagt
gatccatatattaaggccaggcagaacattttggaaggttactttgagcaggtccttcgt
agcctgtacagcactatgtttacaaggaaccctgagaagaaactgaggggaagggaaaat
ttactgaaatccctggagatatatgaaactgaactggaggggaaattctatggaggtgat
gaagttggcatgctggactttcacttgtggccatggatagagcgtatctacaccatatca
cacatcacagggctggaattttctgtggaaaaatttcccaagatgaatgcttggatccaa
aggatgtaccaaacaccagcagtcaaagccacagctctgccaggagaggtacatgctgcc
tttttgaagtcattaatggacagatcgcctaactatgagatagaggtgccagcttcccga
ctgtga

DBGET integrated database retrieval system