KEGG   Lingula anatina: 106176891Help
Entry
106176891         CDS       T04921                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lak  Lingula anatina
Pathway
lak03030  DNA replication
lak03410  Base excision repair
lak03420  Nucleotide excision repair
lak03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lak00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    106176891
   03410 Base excision repair
    106176891
   03420 Nucleotide excision repair
    106176891
   03430 Mismatch repair
    106176891
Enzymes [BR:lak01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106176891
    6.5.1.6  DNA ligase (ATP or NAD+)
     106176891
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106176891
DNA replication proteins [BR:lak03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106176891
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106176891
DNA repair and recombination proteins [BR:lak03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106176891
   NER (nucleotide excision repair)
    Other NER factors
     106176891
   MMR (mismatch exicision repair)
    Other MMR factors
     106176891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 106176891
NCBI-ProteinID: XP_013414920
UniProt: A0A1S3JWW3
LinkDB All DBs
Position
Unknown
AA seq 997 aa AA seqDB search
MQKSITSFFSPGRPKAKDENAGVPSQKPKPKEGNVNSTTKSHKPQSPLKQKNHSPSKDQD
SPLKSRAKNKKGRRIIESDDEEEEEKDIPMEVPERKDEENPKEEKEKKEEIKNDVEDKYD
KVEVVGSPPKPLSQASSSSSSPAVASPHGIPMRKTARKHMKKRKLEEDKPLESDSGNKKS
KLDQETANDTNNVEKNDKAESKSATPEGKAKVSKKPPYEDQDVEMEEQVKEKSPPNKKKG
PKSKKSPQEKKDKGKKVKEEKKEDSGNDKERNVVSEEKEVEKKVVKQELHSFFAPKTNSK
KEPTQEKKIEENTKSTDKTPDKPAAKSGFAGFGDKSAGDGSNYDPSKPNYHPINDAFWKK
GEKVPYLACAKTFQAIESITARLKIVEILANFFRSVIVLSPDDLLPCLYLCLNKLAPAYE
GVELGIGETVLMKAIAQATGRGVDKVKADAQEKGDLGIVAEASRSNQRTMFAPAKLMAST
VFTRLKEIATMSGNSVMSKKIDKIKGMFVACRFSEARYLIRSLGGKLRIGLAEQSVLVAL
AHAVVLTPPGQEYPPEILDASNGISAEKFKKKMDDAALIIKTTYCECPTYDKIIPVLLKE
GLEELPKHCKLTPGIPLKPMLAHPTKGVSEVFRRFEEAAFTCEYKYDGERAQIHVREGGE
INIYSRNSEDNTSKYPDIIGRMKSCMLPSVQTCILDSEAVAWDQEKKSILPFQVLSTRKR
KDADASEIKVQVCVYAFDLLYLNGESLVKEPFSRRRELLHQSFKEVEGEFMFATHLDSKD
TDQIGEFLEESIKGNCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIG
GYHGTGKRAGKYGGFLLACYDEENEEYQTICKIGTGFKDDDLDQHNASLKQHVIDKPRSY
YRCDSSLDPDHWFDAVQVWEVKAADLSISPVHSAAAGLVDPEKGISLRFPRFLRIRDDKK
PEEATSSNQVSELYRNQQQIKNQNTEGKTEEGEEDFY
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatccatcacatcgttcttctcacctgggaggccaaaagcgaaggatgaaaat
gcgggtgttccttctcagaagccaaagcctaaggaagggaatgttaacagcactactaag
agtcacaaaccacaatcacccctaaaacaaaaaaatcatagcccttccaaagaccaggat
tcgcccctgaaaagtcgggccaagaacaagaaaggaagaagaattattgagagtgatgat
gaggaagaggaagagaaggatattccaatggaagttccagaaagaaaagatgaagaaaat
cccaaggaagaaaaagaaaagaaggaagagataaaaaatgatgtagaggacaaatatgac
aaagtggaggtcgtaggttccccacccaaacctctgagccaagcgtcttccagctcttcc
agtcctgctgtggcatctccacatggtataccaatgaggaaaacagcaagaaaacatatg
aagaagcgtaaacttgaagaagacaaaccactagaatctgactctggcaacaagaagtct
aaactggaccaagaaacagcaaatgacactaataatgtggagaaaaatgacaaagctgag
agtaaatctgccaccccagaaggaaaagccaaagtctctaagaaacccccttatgaagac
caggatgtggaaatggaggagcaagtgaaagagaagtctccacctaataaaaagaaaggg
ccaaaatctaaaaaatcacctcaagagaagaaagataaaggaaagaaagtaaaggaagaa
aagaaagaagattcaggaaatgacaaggagagaaatgttgtatcagaagaaaaagaagta
gaaaagaaggtagtaaagcaagagttacacagtttctttgcaccaaaaaccaattcaaaa
aaagaaccaacgcaagaaaagaaaattgaagagaacacaaagagtacagataaaacgcct
gataagcctgcagcgaagagtggctttgctgggtttggagacaagagtgcaggggatggc
agtaactatgaccccagcaagcccaattatcatcccatcaatgatgccttctggaagaaa
ggagaaaaggttccatatttggcttgtgccaagacattccaagcaattgaaagtattaca
gccagattgaaaattgtcgagattcttgcaaacttcttccgttctgtcatagtcctgtct
cctgacgatcttcttccatgtttatatctgtgcctgaataagttagcccctgcttatgaa
ggggtggagttgggaattggagaaactgtcctcatgaaagctattgcccaagccacaggc
agaggtgtagacaaagttaaagctgatgcacaagaaaagggagacttgggaattgttgct
gaggcaagtcgcagtaaccagaggacaatgtttgcaccagcaaagttgatggcgtcaact
gtgtttactagactgaaagaaattgccaccatgtctggtaactcagtcatgtccaaaaag
atagacaaaatcaaggggatgtttgttgcctgccgtttctccgaggcccgttatttgatc
aggtcactcggaggcaaattacgaattggtttggcggagcagtctgtgctggtggcgctg
gctcatgctgtagtgctgacaccaccagggcaagaatatcccccagaaatcttagatgca
agtaatggcatttcagcagaaaaatttaagaaaaagatggatgatgctgcattgattatc
aaaacaacatactgtgaatgtccaacatatgataaaatcatcccagtactactgaaagaa
ggactggaagaactgcctaaacactgtaaacttacaccaggtatacctttaaaacctatg
ttggctcatccaactaagggagtgagtgaagtgttcagaaggtttgaagaagctgccttc
acttgtgaatataaatatgatggagaaagagctcagattcatgtccgagagggaggtgaa
ataaacatttacagcaggaattctgaggacaatacatccaagtatccagatataataggc
cgcatgaagtcctgtatgctgcccagtgtccagacatgtatactggacagtgaggcagtg
gcatgggaccaggagaaaaaaagtattttaccattccaagttctcagtaccagaaagaga
aaggatgcagatgcctcagaaatcaaagtccaagtgtgtgtctatgcatttgaccttctc
tacctcaatggagagtccttggtgaaggaaccatttagcagacggagagagctgttgcac
caatcattcaaagaagtcgaaggggaattcatgtttgccactcatttagattccaaagat
actgaccaaataggagaatttctggaagagtctataaaaggaaactgtgaaggacttatg
gtaaaaacactagatgtagatgctacttatgaaattgccaagcgttcccataattggctg
aagttaaagaaggattatttagagggagttggggacactctggatctggtagttatagga
ggctaccatggcactgggaaaagagcaggaaaatatggtggattcttgttggcttgctat
gatgaggaaaatgaagaatatcaaactatttgtaaaattggtactgggtttaaagatgat
gacctggaccaacacaatgcttctttaaagcagcatgtaatagacaagccccggtcatat
taccgctgtgacagtagccttgaccctgaccactggtttgatgctgtccaagtctgggag
gtcaaggccgctgacctgtccatctcacctgtccactctgctgctgcaggcttggttgac
ccagagaagggaatctctcttcgctttcctcgattcttgagaattcgggatgacaaaaag
ccagaggaggccacatctagtaaccaggtttctgaactgtatagaaaccagcagcaaata
aaaaatcagaacacagaaggaaaaacagaagaaggagaagaagatttttactaa

DBGET integrated database retrieval system