KEGG   Lingula anatina: 106178386Help
Entry
106178386         CDS       T04921                                 

Definition
(RefSeq) histone deacetylase 4-like
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
lak  Lingula anatina
Brite
Enzymes [BR:lak01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106178386
Chromosome [BR:lak03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106178386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 814 aa AA seqDB search
MSSGSTPDSGPNSPPSNTMLQSSNGSLTSLHTREGSSPAELPLQQLKNMMAHGSYSDLTL
YASPSMPNISLGRPPQASPNAQGTNNNSPQSEAEMRAMAAARLGLPLTGHYLPGAYPYYH
PGVMGVDPESTASNPAYISTQMKVLEQMRSTGKLATHPAAGAPYVVPKTGTITDSQVAHA
RLHRHRPLGRTQSAPLPLGQPMLGPQHGMLLQHQHEQFMKENQSYNLKQHIRQQVLQRAG
SKNHMENVDEETEAKLAQEMKESREKLQEEADDIVVIDKDESEATIRRELEQHHHHPQTD
RKAFLSEQRDILRLHPAHAPAVSGTSSVHAPLIPINVPARRPPHRPLSRTQSSPLVTFNF
PRPSNAPEQQEPLPLRFTTGIAYDTMMLKHQCTCGNNQNHPEHAGRIQSIWARLQEAGLA
ARCEKVKARKASREELQSCHSEVYTLIYGTNPLHRQKLDPQILETLPTRFCMLPCGGIGV
DSDTVWNELHTSYAARMATGCAIETSMKVAAGELKNGMAIVRPPGHHAEHQQPMGFCFFN
SVAVAAKQLREKLNLRRILIVDWDVHHGNGTQQVFYNDPSVMYISLHRHDDGNFFPGTGA
LDECGEKEGLGYTVNVAFTGSLDPPMRDADYMMAFRTVVMPIAREFNPELVLVSAGFDAA
KGHPAPLGGYELSGACFGHMTKQLMTLAGGKVVLVLEGGYDLPAICDASEICVKALLGDE
VRPLSEEETNRKPCEAAIKTVQAAISYQARYWPVVTKYADSITMSMMEAQRREQREREEN
DTVSALASLSMVTARRSGGLSSMSSTESEPMEES
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcggaagcacgccagattcaggaccaaactctccccctagtaacacaatgcta
cagtccagtaatggcagcctgacttccttacataccagagagggttccagcccagcagaa
ctccccttgcagcagttgaaaaatatgatggcccatgggagctacagtgacctgaccctg
tatgcctcgccctccatgcccaatatatccctagggagacccccacaggcatcccctaat
gctcagggcaccaacaacaattccccacagtcagaggcagaaatgcgggctatggcagct
gccaggctgggtctgcctttaaccggccattatctccctggtgcatatccctattaccat
ccaggagtcatgggtgttgacccagaatcaacagcgagcaacccagcatacatcagtact
cagatgaaggtgttggagcagatgcgcagcacgggaaaactggccacgcaccctgctgct
ggcgccccctatgtagtacccaagacaggcaccatcacagactctcaagttgcacacgct
cgtttgcacagacaccgtcccctgggcaggacccagtccgcccccctccccctggggcag
cctatgctgggcccccagcatggaatgttactccagcaccaacatgaacagttcatgaaa
gaaaaccagtcttacaatctcaaacagcatatccgtcagcaagtgttacaacgagctggc
agcaagaaccacatggaaaacgtggacgaggaaaccgaggccaaactcgcacaggaaatg
aaagaatcacgtgaaaaactccaagaggaagccgacgacatagtcgtaattgataaggac
gaatcggaggcaacgatacggagagagcttgaacaacatcaccatcatccacaaactgat
cgaaaagcattcctttctgaacaacgcgatattttgcggttgcatcctgcacacgcgcct
gctgtgtcagggacgtcgtctgtccatgctccgctaataccaataaacgtgccagcgcgg
cgtcctccgcatcgtccactctccaggacccagtccagtccactggttacgtttaatttc
ccaaggccatcaaatgcacctgaacagcaggaacctttgccgcttagattcactacagga
atagcctatgacaccatgatgttaaagcaccaatgtacatgtggaaacaaccagaaccat
ccagagcacgcaggaaggatacaaagtatctgggcgcgacttcaggaagcagggcttgct
gcgcgatgtgagaaagtgaaagccagaaaggcaagccgcgaggaactccagtcatgccac
agcgaagtatacacattgatctacgggacaaaccccttacatcgacaaaaactggatcct
cagatactggagactttacccactaggttctgtatgttaccatgtggcgggattggtgtg
gactccgatactgtgtggaatgagctgcatacgtcttatgcagcgagaatggccactgga
tgtgccattgaaacatcgatgaaagttgcagctggggaactgaagaatggcatggccata
gtgcgacccccaggtcatcacgcagaacaccaacaacccatgggtttctgtttcttcaat
tcggtggcagtggctgctaagcagctgagggaaaagttgaatctccgtagaattctgata
gttgactgggacgttcaccatggcaatggcacacagcaggttttctacaacgatcccagt
gtcatgtacatcagccttcatcgccatgacgatgggaatttctttcctggcactggtgct
ctggacgaatgtggcgagaaggaaggccttggttacaccgtcaatgtcgctttcacgggc
agtttagatcctccaatgagagatgctgattatatgatggcattcaggacagtagtgatg
ccaattgctcgggaattcaacccagagcttgtgttggtgtctgcggggtttgatgctgcc
aagggtcaccctgctcctctgggtggatatgagttgtctggagcatgttttggtcacatg
accaagcagctcatgaccctggcgggcggcaaagttgtcttagttcttgaaggaggctac
gacctgcctgcgatatgtgatgcttctgagatctgtgtaaaggccttgctgggagacgag
gtgagacctctcagcgaagaggagaccaataggaagccctgtgaagctgcaataaagacc
gtacaagctgcaatcagttatcaagctcgttactggccagtggtcaccaaatatgcggac
agcatcacaatgtccatgatggaggctcagaggagagagcaacgagaaagagaagagaac
gacaccgtctccgctctagcctctctgtccatggtcactgccagaagaagtggtggactc
tcctcaatgtcatcgacagagtctgaacccatggaggaatcttga

DBGET integrated database retrieval system