KEGG   Lingula anatina: 106180552Help
Entry
106180552         CDS       T04921                                 

Definition
(RefSeq) superoxide dismutase [Mn]-like isoform X1
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lak  Lingula anatina
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:lak00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    106180552
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    106180552
Enzymes [BR:lak01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106180552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 247 aa AA seqDB search
MAIVTVLSCLITLVVTPHQTAAIGMYEESAVPKEAYPLPPLPYPYGGLEPHMDERTVQIH
HQGHHAAYTTKMNAALKQWREEDPGNTFAKSSILNILQNVSSVPEKYRTALRNNGGGYFN
HAIYWACMSPGGAAITPDLKSDIIQNFGTYDNFKDQFTTKAMALFGSGYVWLSRGGNDKL
VISTTANQDSPVTESFRPILVIDIWEHAYYLKYQYRRADFVAAWWKLVDWKAVVDLDKWW
RVNYRYG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgtcaccgtgctttcatgtcttataactctggttgtgaccccacatcagaca
gctgctatagggatgtatgaagaaagtgctgtcccgaaagaagcctacccgttaccacca
ctgccatatccctatggtggtctggagccgcacatggacgaaagaacggttcagattcac
caccagggacatcatgcagcttatacgaccaagatgaatgccgcattaaaacaatggaga
gaagaggatcccggaaacacgttcgccaagagctccattttgaacattctccaaaatgtg
tccagtgttcctgaaaaatataggacagctttgagaaacaatgggggcgggtatttcaac
catgctatatactgggcttgtatgtcccccggaggtgcagctataactccagatttgaaa
agtgatataatacagaattttgggacatacgataatttcaaagaccagtttacaacaaag
gccatggcattgtttggttcaggatacgtgtggctatcaagaggagggaatgacaagcta
gtcatttccacaacggcaaatcaggactcgcctgtgactgagagtttccgcccaattctg
gtgattgacatctgggagcatgcgtactacctgaagtaccaatatagacgggcagacttc
gtggcagcttggtggaaattggttgactggaaagctgttgtggatctggacaagtggtgg
agggttaactacaggtacgggtag

DBGET integrated database retrieval system