KEGG   Lactobacillus amylolyticus L6: B1745_01505Help
Entry
B1745_01505       CDS       T05057                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lamy  Lactobacillus amylolyticus L6
Pathway
lamy00010  Glycolysis / Gluconeogenesis
lamy00260  Glycine, serine and threonine metabolism
lamy00680  Methane metabolism
lamy01100  Metabolic pathways
lamy01110  Biosynthesis of secondary metabolites
lamy01120  Microbial metabolism in diverse environments
lamy01130  Biosynthesis of antibiotics
lamy01200  Carbon metabolism
lamy01230  Biosynthesis of amino acids
Module
lamy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lamy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B1745_01505
  Energy metabolism
   00680 Methane metabolism
    B1745_01505
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B1745_01505
Enzymes [BR:lamy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     B1745_01505
Membrane trafficking [BR:lamy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    B1745_01505
Exosome [BR:lamy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   B1745_01505
  Exosomal proteins of melanoma cells
   B1745_01505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ARD06400
UniProt: A0A1V0JC10
LinkDB All DBs
Position
289481..290158
Genome map
AA seq 225 aa AA seqDB search
MVKLVLVRHGESVANAANVYTGWNDVPLTKKGEQQARKAGRLINQISDFHPTHIHTSVLS
RAIVTANIVSDVCNFLYLPITKTWRLNERHYGALRGLNKDISRKVFGVEQVLMWRRSFDS
VPPKQGSPIVDRRYRLCDQHLMPRAESLHQTQLRLMPYYYDEVASRMMRGEDQLIVAHGS
SLRALIKKLEGINDHDIVKLEVPNAEPIIYTMNDDMRIIDKQILN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaattagttttagttagacatggagaaagtgtagctaatgccgctaatgtgtat
actggctggaatgatgtaccattaaccaaaaaaggagagcagcaggcacgcaaagcagga
cgcttaattaaccaaatctctgattttcatcccacgcatatccatacttcggttttgtcg
cgggcaattgtcacagccaatattgtatccgatgtgtgcaactttttgtatttgccgatc
actaagacatggcgcctaaatgaacgccactatggcgctttaaggggccttaacaaggac
atctcgcgcaaggtctttggcgtagagcaagtcctaatgtggcggcggagttttgattcc
gttccgcctaagcaaggatcgccgattgttgatcgtcgttatcgtttatgcgatcaacat
ttaatgccacgtgcagaaagtttgcatcagactcagttgcgtttaatgccatattattat
gacgaagttgcttcaaggatgatgcgtggggaggatcaattaattgttgctcatggttca
agtttgcgtgcattaatcaaaaaacttgaaggtattaatgaccatgacattgtaaaattg
gaagttcctaacgcggagccaattatttacacaatgaatgacgatatgagaattatagat
aaacaaattttaaattag

DBGET integrated database retrieval system