KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0599Help
Entry
Lacal_0599        CDS       T01533                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lacal_0599
  Energy metabolism
   00680 Methane metabolism
    Lacal_0599
Enzymes [BR:lan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Lacal_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
658613..661192
Genome map
AA seq 859 aa AA seqDB search
MPTQPKLTRFKQTVLSKYQIYNSIFMTLPFDSISKTGVLLPLFHETCKNGFENGDNPTTI
VNTFFKKYQARRSKESQIDLLFRFIQYIERQVVLFDAIEDAAFPVVNNMDGIGTLRSLKE
TASSENKLEKLQQYLEEFKVRIVLTAHPTQFYPGAVLGIITDLTEAVKENDLLRINDLLA
QLGKTPFFKHKKPTPYDEAVSLIWYLENVFYKSFGSIYDYIQQNIFDGKHINNDIINIGF
WPGGDRDGNPFVTPEITLNVANRLHETIIKNYYRDIRKLKRKLTFKDVEERVFNLETELY
NIISHEKSTLTLEHFSSELENIKQIIIDKHQSLYAEEINSLINKVHLFGFHFANLDIRQD
SRKHNQFFNNMVDALLENKSEIFPKNYHDLNEKEQVKILSKVKGNIDLSLIKDEETLKAL
NTMKAIKTIQNTNGEKAANRYIISNNQTTLNVMQLFAMLKLVAFQDKLTVDIGPLFETIT
DLENAPAVMEALYTNPEYAAHLKSRGNKQTIMLGFSDGTKDGGYLMANWAIYKAKENLTA
ISRKYDVTAIFFDGRGGPPARGGGKTHNFYASLGPTIEDKEVQLTIQGQTISSNFGTLDS
SQYNLEQLITSGIHNSFSDNDLSMLPENRVVMDDIANLSYEAYVAFKAHPKFISYLEHMS
TLKYYAKTNIGSRPSKRGKAKGLVFEDLRAIPFVGSWSQLKQNVPGFFGVGTALKKYEDA
GEFDKAQRLFKTSDFFKTLIENSMMSLSKSFFDLTKYMAEDPEYGAFWKVIYNEYETTKR
LILKLTGYKELMQEEPAGKASIAVRESIVLPLLTIQQYALKKIQELEKAEVKDEEQIKIF
EKIVTRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgcctacacagcctaaactcactcgatttaaacaaactgtattgtctaaataccagata
tacaatagtatattcatgaccctaccttttgattctatttctaaaacaggcgttttatta
ccgctttttcatgaaacctgtaaaaacggttttgagaacggagataacccaaccacaatt
gttaataccttttttaaaaaataccaagctagaagatctaaagagagccagattgattta
ttgtttcgctttattcaatatatagaacgccaagttgtattatttgatgctattgaagat
gccgcttttcctgtagttaacaacatggatggtattggtactttaagaagtttaaaggaa
actgcctcttctgaaaataaattagaaaaactacaacaatatttagaagaatttaaagta
agaattgttttaaccgcgcatcctactcaattttatcctggtgcagttttaggtattata
acagatttaactgaagctgtaaaggaaaacgacctacttagaataaacgatttattagcc
caacttggcaaaacacctttctttaaacacaaaaaaccaactccgtacgacgaagccgtt
agtttaatatggtatttagaaaatgtattttataaatcgtttggtagtatttacgattat
atacagcaaaacatatttgatggtaaacatattaataacgatattattaatattggcttt
tggcctggtggagatagagatgggaatccttttgttactccagaaatcactttaaatgtt
gcaaacaggctacacgaaactattattaaaaactactatagagatatacgtaaacttaaa
agaaaactaacgtttaaagatgttgaagaacgtgtttttaacttagaaacagagctttac
aatattatctcacatgaaaaatctactttaacattagagcattttagctcagaattagaa
aacataaagcaaattataattgataaacatcaatcgctttatgccgaagaaattaacagc
ttaattaataaagttcatctctttggctttcattttgctaatttagatataaggcaagat
agcagaaagcacaatcaattttttaataatatggttgatgctttacttgaaaacaaaagt
gaaatatttccaaaaaattaccatgatttaaacgaaaaggaacaagttaaaatactctct
aaagtaaaaggaaatatagacctttcgttaataaaagacgaagaaactttaaaggcttta
aacactatgaaagccattaaaaccatccaaaacactaatggcgaaaaggctgccaaccgt
tatataattagcaacaaccaaacaactttaaatgtcatgcaattgtttgctatgcttaaa
cttgttgcttttcaagataagcttacggtagacatcggtccgctttttgaaaccattaca
gatttagaaaatgctcctgctgttatggaagcactgtacactaatccagaatatgcagca
catttaaaatctagaggaaacaaacaaactataatgcttgggtttagcgatggtacaaaa
gatggtggatatcttatggcaaattgggctatttataaagcaaaagaaaatcttactgca
atttctagaaagtatgatgttaccgccattttctttgacggtcgtggcggtccaccagct
cgtggtggaggaaaaacacataatttctatgcgtcgttaggaccaacaattgaagataaa
gaagtacaacttactattcaaggccaaactattagctctaattttggaacattggattct
tctcaatataatttagaacaactaataacttctggtattcataatagttttagcgataat
gatttaagcatgcttcctgaaaacagagtcgttatggatgatattgcaaaccttagttac
gaagcttatgttgcgtttaaagcacatccaaaattcatttcctatttagaacacatgagt
acattaaagtattatgctaaaacaaatataggaagtcgcccatctaaaagaggaaaagct
aaaggtttagtttttgaagacttaagagctataccgtttgtaggctcatggagccaatta
aaacaaaatgttccaggattttttggtgttggtactgctttaaaaaaatatgaagatgca
ggagagtttgataaagctcaacgcttatttaaaacatcggatttctttaaaacattaatt
gaaaacagtatgatgtctttatcgaaatcatttttcgatttaacaaaatacatggccgaa
gatccagaatatggtgctttttggaaagttatttataatgaatacgaaaccacaaaacga
cttatattaaagcttacaggatataaagaattaatgcaagaagaacctgccggaaaagca
tctatagctgttagagagtctattgtactacctttattaacgatacagcaatatgcttta
aaaaagattcaggaacttgaaaaagcagaagttaaagacgaagagcaaattaaaatattt
gaaaaaatagtaacacgctctttatttggaaatataaatgcaagccgaaattcagcttaa

DBGET integrated database retrieval system