KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0723Help
Entry
Lacal_0723        CDS       T01533                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lacal_0723
  Amino acid metabolism
   00310 Lysine degradation
    Lacal_0723
   00380 Tryptophan metabolism
    Lacal_0723
Enzymes [BR:lan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Lacal_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(819034..821790)
Genome map
AA seq 918 aa AA seqDB search
MDKYSFLNAAHTAYFADLYEQYLENPDSIEPSWRAFFQGYDFGSENYGMDGELVEGVSTQ
IPEHVQKEFQVVKLIDGYRNRGHLFTKTNPVRERRKYAPTLEIENFGLTKNDLSTVFNAG
EILGIGSQTLEEIIKHLERIYCDSIGVEYMYIRKPEEIKWIQDKLNINDNQPKFSSDEKK
HILKKLNEAVSFESFLHTKYVGQKRFSLEGGEALIPALDAVIEKAAELGVEEFVMGMAHR
GRLSTLTNIFGKSAKDIFSEFDGKDYEEEVFDGDVKYHLGWTSHRGTDSGKDIKLSIAPN
PSHLETVGAVVEGIVRAKQDKDFSDDFSKVLPIVVHGDAAIAGQGLVYEVVQMAQLDGYK
TNGTIHIVVNNQVGFTTNYLDARSSTYCTDVGKVTLSPVLHVNADDAEAVVHATLFALDF
RMQFKRDVFIDMLGYRKYGHNEGDEPRFTQPKLYKAISKHANPRNIYAEKLIAEGVIGKD
HVKQLEKNYKDSLEEKLDASRKEDKTVITPFMESVWEDFTRVDEVEMMKTVDTKVSQKEL
EKITKVISNLPEDKKFIRKIERLVQSRQTMFDENKLDWAMAEHLAYGTLLEEGYNVRISG
QDVERGTFSHRHAVVKVEDSEEEIILHNNISDTQGQFYIYNSLLSEYGVVGFDYGYAMAS
PKTLTIWEAQFGDFSNGAQIMLDQYISAGEDKWKTQNGLVMLLPHGYEGQGAEHSSARME
RYLQLCAKDNMYVADCTTPENMFHLLRRQMKSNFRKPLIIFTPKSLLRHPKCVSTVEEFA
NGSFKTVIDDDAVEASKVKTLVLLTGKFYYDLDEERNKQGRDDIAFIRIEQLFPLPVEEI
RKTIQNYTNVDEIVWAQEEPRNMGAYSHMLMHLDEAKTFRAATRRAYGAPAAGSSTRSKK
RHQEVIDYVFDKSKNNQR
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggataaatattcctttttaaacgcagcacatacagcatattttgctgatttatacgaa
caatacttagagaacccagattctatagaaccaagctggagagccttttttcaaggttac
gattttggtagtgaaaactatggcatggatggagaacttgtagaaggagtttctacacaa
attccagaacatgttcaaaaagaatttcaggttgtaaaactaatagatggttaccgtaat
agaggtcacttatttacaaaaactaatcctgttagagagcgtagaaaatacgctccaact
ttagagattgagaattttggtttaaccaaaaacgacttgtctacagtttttaatgctgga
gaaattctaggtataggttctcaaactttagaagaaattattaaacacctagagcgtatt
tactgcgattctattggtgttgagtatatgtatattagaaaaccagaagagattaaatgg
attcaggacaagttaaatattaacgataaccaacctaaattttcttcagacgagaaaaag
catatcttaaaaaaacttaacgaagccgtatcttttgaaagctttttacatacaaaatat
gttggtcaaaaacgtttttctttagaaggtggagaagcattaattcctgctttagacgct
gtaattgaaaaagcagcagaattaggtgtagaagaatttgtaatgggaatggcacataga
ggtcgactttctacattaacaaatatctttggaaaaagtgcaaaagatatttttagtgaa
tttgacggtaaagattatgaagaagaagtttttgatggtgatgtaaaataccacttaggc
tggactagccatagaggcacagattctggaaaagatataaaactaagtatcgctccaaac
ccatcacacttagaaactgttggtgcagttgtagaaggaattgtaagagcaaaacaagat
aaagattttagcgacgattttagtaaagttttaccaatagtagtacatggtgacgctgca
attgcaggtcaaggtttagtatacgaagttgtgcaaatggcacagttagatggatataaa
acaaatggtactatacacatagttgtaaataaccaagttgggtttacaacaaattattta
gatgccagatcaagtacatactgtacagatgtaggtaaagtaacactatcacctgtactt
cacgtaaatgcagacgacgcagaagcagttgtacatgctacattatttgcattagatttt
agaatgcagtttaagcgcgacgtatttatagatatgctagggtatagaaaatatggccat
aacgaaggtgatgagccacgttttacacaaccaaaattatacaaagcaatatctaagcat
gcaaacccaagaaacatttatgccgaaaaattaattgcagaaggtgttattggtaaagat
catgttaaacaattagaaaaaaattataaagacagtcttgaagaaaaattagatgcttca
agaaaagaagataaaacagttataacgccatttatggaatctgtatgggaagattttact
cgtgtagatgaagtagaaatgatgaaaactgtagacacaaaagtgtcccaaaaagagtta
gaaaaaataactaaggttatatctaacctaccagaagataaaaagtttatacgtaaaata
gaaagactagtacaatctcgtcaaacaatgtttgatgaaaataaactagattgggctatg
gcagagcatttagcttacggtacacttttagaagaaggctacaatgttagaatttctggt
caagatgtagaaagaggaacattctctcatagacacgcagtagttaaagttgaagatagc
gaagaagaaataatattacataataatattagcgatacgcaaggtcaattttatatctat
aactcactattatcagagtatggagtagtaggtttcgattatggttatgcaatggcaagc
ccaaaaacattgaccatttgggaagcgcaatttggagactttagtaatggagcacaaata
atgttagaccagtacatatctgcaggagaagataaatggaaaactcaaaacggtttggta
atgttattgccacatggttatgaaggtcaaggcgcagaacattcatcagcaagaatggaa
cgttacctacaactatgtgcaaaagataatatgtatgttgcagattgtacaacgccagaa
aacatgtttcacttgttaagaagacaaatgaaatctaactttagaaaaccattaataatt
tttacaccaaaaagtttattacgtcatccaaaatgtgtttctacagtagaagaatttgca
aacggaagctttaaaactgtaatagatgatgatgccgtagaagcaagcaaagtaaaaaca
cttgtattgttaaccggtaaattttattacgacttagatgaagaacgcaataagcaaggt
agagatgatattgcatttataagaatagaacaattattcccactaccagtagaagaaata
agaaaaacaatacaaaactatactaatgtagatgaaattgtttgggcgcaagaagagcct
agaaatatgggagcttatagccatatgttaatgcacttagacgaggcaaaaacatttaga
gcagcaacgcgaagagcttatggagcaccagcagcaggaagtagtacaagatctaaaaaa
cgtcatcaagaagttatagattacgtatttgataaaagtaaaaataaccagcgataa

DBGET integrated database retrieval system