KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109328072Help
Entry
109328072         CDS       T04664                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2-like
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 109328072
NCBI-ProteinID: XP_019416874
LinkDB All DBs
Position
LG15
AA seq 1955 aa AA seqDB search
MGSCGTSAMVDDLSGGSVAENHLCSELLVQCVPLQQTCSKEACNELDSNVDVSGLMDYCM
GSAVEGHVESASFVNVSEGSGDQLVSECKNADKLLLENTSEDDCQNQSGPCCENVEVSGL
NSGGLYPEGNFQDEGHLDIPSESITVIGLPEHCAQQNEHKDDKSNILPLEGEDSALAEAR
NSGVDLLDDASNCVSVFSHFEMSLKSESIAHLLVDRNQQNDLDDVFRIADPMSNVVEKCD
DSGGREADACKQVSPSQFMEVSSHALYTEVESTSDQQCDQKDCEDWDSEEKVKAFADIEN
DIIDSYARKHKHFTKVSSGGNSPVVESRCEPTLLGQGNKMNNSICQIEDSFCELKNCPSE
ETVICTLRKPFYPEPGQPSVVIITSSSSKDVPDSLPNGDNVSINNNAVNNPGHTDIVEID
CTAERTRLPSQRNSRSTKLGRKTQSKNASRRGKNNSNAMHLGGCMLEASRKKRSCISKPA
RSSMWGLLVNIQQFFEQDNELGASEAMSQELGKAKRKRQSCEVIKSGANSSSSDSVQKCS
ASTTRFRLRVKIGKGIDLSRSDVLIPEAVDALASTSHLGCGSGSPKVADNAEGKICEVAA
LGKSESFKNEPETDSIVLNGQTKNSHSGSTSITEKSEGDAEEPCLLVAPKIEVESLIEPT
NNKGMDPGTSPDSEVINTIPEDQAGEGHEEDLYHAVLGSCKEFSSNLDVTITKRGEKKDM
LICSSDCISEDGAKNNRAKNSKNPRRKKKFSAALCSLELPTSTEINASRESVSCKDLSTE
PSLFSGEIELGDSAETLKVEVEVKTTCNRPVEHEFSESQGSENLLSPTKSLGRKLPRSLT
PIKVSKTKSKASVSTSKKKTTYRCNEKQKKSTNKNEVKGKGVLSKVKCEVEDHPPTGVDV
GNHKLDAVGEVNAGENRVSVNVSNLDMIPGAGIGEQRLSPRNAWVRCDDCHKWRRIPAVL
ADLINETNDTWTCKDNGDKTFADCAIPQEMSNAEINAELGISDEEDAYDDSKNYKLLEYR
QPSVSQKSTFSCISTNEFLHRSHKTQTIDEIMVCHCKPPQEGKLGCGDECLNRILNIECV
HGTCPCGDHCSNQQFQKRKYASLNWFKCGKKGYGLKALEDIAEGQFLIEYVGEVLDAHAY
DARQREYAMKGHRHFYFMTLNGSEVIDASAKGNVGRFINHSCDPNCRTEKWMVNGEICIG
LFAMKDIKQDEEVTFDYNYVRVFGAAAKKCYCGSPHCRGYIGGGDPLDDELIVQGDSDDE
FPEPVMLTEDGEIKNSVTQSAKHVLKESYLLNKSTTSIDVDNIPEKESYVNPTSAVSLMH
RSSKMDVSKDCLPPSVHAQDISQQMEDLKDKPMPDIQPGYAMGSDLANNKSHTQELDSTS
LTTVSKVLPNPTGSNRESHLHVKAPKRSVSVKKGKICANPPNGLKAVIANQSQVSSFKLK
KAVEGTSNGRFEAVQEKLNELLDGDGGVSKRKDATKRYLKLLLLTVALGDRSNGEAIQSN
RDLSMILDALLKTKSRTVLNDIINKNGLQMLHKIMKQYRQDFKKIPILRKLLKVLEYLAE
GKILTLEHINSGPPCHGMESFRESMLSLTEHDDKKVHQIARSFRDTWIPRPARKHHMDRD
GNRVESHRSFNHNRYSSSHNHRHEQDLRPTEAIDRLQPPTPVTTSVDAGPQEGCSPLSHD
GTENKGIKKRKRKTRWDQPAETNSYPIVVSGSIHGDQNIQEDVPPGFPCPAGSLPAPLNS
GDPASRNACHTGFSFNTVIVHPKEKFNSGLPVLYGMPLSVVHQYGTPHAEITESWVTAPG
MTFKPFPPLPSYPRDEKNFHPSSSTNAMSIDQPAKVRQCDSSGPVIYSADDMVPNTTGAN
SEDTNVPCEDNEHISKRLKGDSHDLGSEYFRQQEWNNSKIYRPWFRRNAWKCDVKLNNSS
GDICSIGVGDDVPKQPKGTYSEDVVRRDEKGGNNI
NT seq 5868 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgtgtgggacttcggctatggttgatgatctctcaggtgggtctgttgctgag
aatcatttgtgctcagagttactggtgcagtgtgttcctttgcagcagacatgctcaaaa
gaagcttgcaatgagctggactctaatgttgatgtctctggtctgatggattattgtatg
ggttcggctgtagagggccatgtggagtctgcaagctttgttaatgtttctgagggatca
ggggatcaattggtgagtgaatgtaaaaatgctgataagttgctattggagaatacctca
gaagatgattgtcaaaatcaatccgggccgtgttgtgagaatgttgaagtttctggtcta
aatagtggtgggttgtatccagaaggaaatttccaagatgaaggccacttggacattcca
tcagagtccataactgtgattggcttgccggaacattgtgctcaacagaatgagcataag
gatgataagagcaatatattacccttagaaggagaggattcagcactcgcagaagcgaga
aacagcggtgttgatttacttgatgatgcttccaattgtgtgtctgttttcagtcatttt
gaaatgtccttgaaatcagaatctattgctcacttgctagttgatcgcaaccaacaaaat
gacctggatgacgttttcagaattgcagatccgatgtcaaatgttgtggaaaaatgtgat
gattctggtgggagggaagctgatgcatgcaagcaggtttctccctcacaatttatggaa
gtgtcatcacatgcattatatacagaggtagagagcacaagtgatcagcaatgtgatcag
aaagattgtgaggattgggatagtgaagaaaaggttaaagcttttgctgatatagaaaat
gacattattgattcatatgcaaggaagcacaaacacttcaccaaagtctcctcaggaggg
aattcacctgtagttgaatcacgttgtgagcctaccctgttgggtcaggggaataaaatg
aataatagtatatgtcaaatagaagatagtttttgtgaattgaagaattgcccgtcagag
gaaactgtcatctgtacccttagaaaaccattttatcctgaaccaggtcagccctctgtt
gttataatcactagtagctcttcaaaggatgtccctgattcgcttcctaatggtgataat
gtttccatcaataataatgctgtcaacaatcctggacatacagatattgtcgaaattgat
tgtactgctgaacgaacacggcttccttctcaaaggaatagtcgaagtacaaaacttggt
cgtaagacacaatccaaaaatgcttctagaagaggcaagaacaactccaatgcaatgcat
ctaggtggttgtatgttagaggcttctagaaagaaaagaagttgtatctccaaaccagct
cgttcctctatgtggggattgcttgtgaacattcaacagttttttgagcaagataatgag
cttggggccagtgaagccatgagccaagaattgggcaaagctaaaagaaaacgtcaaagt
tgcgaagtgattaaaagtggtgcaaattctagttcatcggattcagtgcagaaatgttct
gcttcaactactcgtttccggttgagggtgaagattgggaaaggaattgatttaagtcgc
tcagatgttttgattccagaggctgtagatgctttggcttctacttcccacttggggtgt
ggttcgggttcaccgaaagtagcagacaatgctgaagggaaaatttgtgaagtggctgct
ttaggcaagtcagaatcttttaaaaatgagccggagacagattctattgttctaaatgga
caaactaaaaatagccactcaggaagtacctcgataacagagaagtcagaaggggatgca
gaggaaccgtgtcttttggttgctccaaagatagaggttgaatcattgattgagccaacc
aataataagggaatggatcctggaacttcgcctgactcagaagttatcaatacaattcca
gaagatcaggctggagaaggacacgaagaagatttatatcatgctgttttaggttcttgt
aaagagttcagctctaatttggatgttaccatcaccaagcgaggggagaagaaagacatg
cttatttgttcaagtgattgtatatctgaagatggagctaagaataatagagctaagaat
tcaaagaaccccagacgtaagaagaaattcagtgctgctctttgctcgttagaattgcct
acttccactgagataaatgcttcaagggaatctgtaagctgtaaagatttgtccacagaa
ccatcgctcttttctggagagattgaactaggagactctgctgagactttgaaagttgag
gtggaagttaagacaacttgcaaccgaccagttgagcatgagttttcagaatctcagggt
tctgagaacttgctatctcctacaaaatctttggggcgaaaacttcctagaagtcttacc
cctattaaagttagcaagaccaaatctaaagcttctgtctcaacgagcaagaaaaaaact
acttatagatgcaatgagaaacaaaaaaagtcaaccaataagaatgaagtcaagggaaaa
ggtgtcttgtctaaagttaagtgtgaagtggaagatcacccacccacaggagtagatgtt
ggaaatcacaagttggatgctgttggagaagttaatgctggtgaaaacagagtatcagtc
aatgtatctaacttggacatgatacctggtgctggtataggagagcagcgtctatcacca
cgtaatgcatgggtgcgttgtgatgattgtcacaaatggcgacgcattccagctgttctt
gcagacttaattaatgaaacaaatgacacctggacatgtaaggacaacggggataaaacc
tttgctgattgcgctatccctcaggaaatgtcaaatgcagagattaatgctgagttggga
atatcagatgaagaagatgcttatgatgactccaaaaattataagctattggaatatcga
cagccatcggtttcccagaagtcaactttttcctgtatttctaccaatgagtttctgcat
cgtagccataaaactcagactattgatgagataatggtctgtcattgcaagccacctcaa
gaaggcaagttgggctgtggggatgaatgtctaaaccggattcttaacattgaatgtgtg
catggaacctgcccatgtggggatcattgttccaatcaacagttccaaaagcgcaagtat
gccagcctgaactggtttaaatgtgggaaaaagggttatggactgaaggcactagaggat
attgctgaaggccagtttcttattgaatacgttggagaggtgcttgatgcacatgcttat
gatgcccggcaaagagagtatgcaatgaagggtcataggcatttctattttatgaccttg
aatggcagtgaggtgatagatgcaagtgcaaagggaaatgtggggcgtttcattaatcat
agttgtgatcctaattgtcggacagaaaagtggatggtgaatggggaaatctgtattgga
ctgtttgcaatgaaggatattaagcaggatgaagaagtgacatttgattacaactatgta
agggtttttggcgctgctgccaaaaaatgctactgcggctctcctcattgtcgaggttat
ataggtggtggtgatccacttgatgacgaactgatagttcaaggtgattcagatgatgaa
ttcccagaacctgtgatgcttactgaggacggtgaaataaaaaacagtgtgacccagtct
gctaagcatgtgttaaaagagagctatctattgaacaagtctacaacttctatagatgta
gataatattccagagaaagagagttatgtgaaccctacttctgctgtttccctgatgcat
agatcatccaaaatggatgtctcaaaggactgtttaccgccttctgtccatgcacaagac
atttctcaacaaatggaggatctaaaagacaaacccatgcctgatatacaaccaggatat
gcaatgggatcagatcttgcaaacaataagtctcatactcaagaactagactctacatcc
cttaccactgtcagcaaagtgctaccaaatcctactggtagtaatagggaatcacatctg
catgtgaaggctcctaaacgaagtgtttctgttaaaaagggtaagatttgtgctaatcct
ccaaatggcctcaaagctgtgattgccaaccaatcccaggtgtcatctttcaaactaaaa
aaagcagttgaaggaacttccaatggccggtttgaagcagttcaggagaaacttaatgag
ttgctggatggagatgggggagtaagcaaaagaaaagatgccaccaaacgctacttgaaa
cttttgcttctcactgtggcattgggtgataggagcaatggtgaagcaattcaaagtaat
cgagatctttccatgatccttgacgcccttctgaaaacaaaatctagaacagtgctgaat
gatataattaacaaaaatggtttacagatgttacacaaaataatgaagcagtacaggcag
gacttcaaaaaaataccaatactacgaaagcttcttaaggtcttagagtacctagcggaa
ggcaagatattgacacttgaacatatcaatagtgggcccccttgtcatggaatggagagt
tttagggaatcgatgctgtctttaacagagcatgatgacaaaaaggtccatcaaattgct
cgaagcttccgagacacatggattcctaggcctgccagaaaacatcatatggacagggat
ggtaatagggtggaatctcatagaagcttcaaccataacagatattcatcatcacacaac
cataggcatgagcaggatttaagacctacagaggcaattgatcgtcttcagccgccaacg
cctgtgacaacttcagtagatgcaggtccccaggagggctgctctccattatctcacgat
gggactgaaaacaaagggattaaaaaacgtaagcgcaaaactcgatgggatcaaccggca
gagacgaactcatatcccattgttgttagtggctctattcatggagaccagaacattcag
gaggatgttccaccagggttcccatgtccagcaggttcattacctgctccactgaactca
ggtgatcctgcttcgcgaaatgcatgccatactggattttccttcaatacagtcattgtt
catccaaaggagaagtttaactctggcttgcctgtcttatatggaatgccattgtctgtt
gtccaccaatatggaacacctcatgctgaaatcacagagagttgggtcactgcacctggc
atgactttcaaaccatttcctccattaccctcatatccacgtgatgagaaaaacttccat
ccttccagttctactaatgctatgtcaattgatcagccagctaaagttagacagtgtgat
agcagtggtccagttatttattctgcagatgatatggttcccaacacaactggtgctaac
tctgaagacacgaacgttccatgcgaggacaatgaacacatttctaaacgattgaagggc
gactcccatgatttgggatcagagtactttagacagcaggaatggaataattcgaaaata
tatcgaccatggtttaggaggaatgcgtggaaatgtgatgtgaagttgaacaactcaagt
ggtgatatctgcagtataggtgtaggagatgatgtaccaaaacaaccaaaaggcacatat
tcagaggatgtagtccgtagagatgagaaaggtggcaataatatttaa

DBGET integrated database retrieval system