KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109330961Help
Entry
109330961         CDS       T04664                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lang00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109330961
Enzymes [BR:lang01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109330961
Chromosome and associated proteins [BR:lang03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109330961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 109330961
NCBI-ProteinID: XP_019420769
LinkDB All DBs
Position
LG17
AA seq 701 aa AA seqDB search
FPPPPPPPPPPPPPPPXSPGGALKVPKPEPFDEFLTPHHDSEVEEDDAEKQLQLYSDFCR
VSNLFREAFGKTLHQQFGSDDDFHYDLDSHLVDVKVSVSDPILENGFDDLNFPVLNSNHV
DPNAGAIVAVSSPQGQAVEVTTTPRRKPNRMKELMRAMDLGVKDQVHFREVVRKTRMVYE
SIRVVTSIEDEKRVAAAVEEKKRVIAAMAAAGSGEIEGSGSKSYRRPRLRGDLRAASLMR
DQGLWLNRDKRIVGAIPGIDVGDVFLFRMELCVLGLHGQIQAGIDYLPGSMSSNGEPIAT
SVIVSGGYEDDLDDGEVIVYTGQGGQEKNSYRHASHQKLEGGNLALERSMHYGIEVRVIR
GVRYEGSASSSGKVYVYDGLYKIVDCWFDVGRSGFGVYKYKLRRIEGQEKMGSAILKEAR
DVRRSGIDFNPMHCLSVDISNSKENFPVRLFNDIDDNRDPLCFEYITKTTFPQFVFHQSG
KATGCDCVDGCAHDCFCFMKNGSEFPYNQHGRLVRGKPLIFECGPFCRCPPHCRNRVTQK
GPKNRLEVFRSTQTGWGVRSLDLIHAGAFICEYAGVILTREQAQILTMNGCDSSIHPNQF
SKRWAEWGDISQIYSDYVRPSHPSVPPLDFSLDVSTMRNIACYMSHSSTPNVFVQFVLYD
HNNLMFPHIMIFALENIPPMRELSLDYGVADECTGKLSICN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
ttcccaccaccacctccaccaccaccaccaccacctcctccaccaccgncttctcccgga
ggagctttaaaagtacccaaacctgaaccattcgatgaattcctcaccccacaccatgac
tccgaagtagaagaagacgatgccgaaaagcagcttcaactttactctgacttctgtcga
gtctccaatctcttccgtgaagcattcggtaaaacacttcaccaacaattcgggagtgat
gatgattttcactatgaccttgattctcaccttgttgatgttaaggtttcagtttctgat
ccaattttggagaatggttttgatgatttgaatttcccggttttaaattcaaaccatgta
gaccccaatgcaggtgcaattgttgcagtgagttcacctcagggtcaggctgttgaggta
accaccacgccgaggcgaaagccgaaccgaatgaaggagctcatgagggcgatggatctt
ggagtgaaggatcaggtgcatttcagggaggtggtgaggaagactaggatggtttatgag
tcgattcgtgtcgtgacgtcgattgaggatgagaaaagagtggctgctgctgttgaagag
aagaagagagtgattgctgctatggctgctgcagggagtggagagatagaaggaagtggc
agcaagagttataggaggccgcgtcttcgaggggacttgagggcagcctcgttgatgagg
gatcaaggtttgtggctgaaccgcgataagcggatagttggcgcgattccaggtatagat
gttggtgatgttttcttgtttaggatggaattgtgtgttctcgggttgcatggtcagata
caggctgggattgattaccttcctggtagtatgagctccaatggcgagccgatagctact
agtgttattgtttcgggtggttacgaggacgacttggatgatggtgaagttatagtgtac
actggtcaaggtgggcaagagaagaattcttatagacatgcttctcatcagaagttggag
ggagggaaccttgcactggaaaggagtatgcattatgggattgaggtgcgagtcattcgc
ggggtgaggtacgaaggaagtgcatcgtcgtccggtaaggtttatgtttatgatggattg
tataagattgttgattgctggtttgatgtggggagatctggttttggagtttataagtat
aaacttcggagaatcgaagggcaagagaagatgggtagtgctattcttaaagaagctagg
gatgttaggaggagtggaattgatttcaatcccatgcattgtctctctgtagatatttca
aacagtaaggagaatttccctgtccggctttttaatgacatagatgacaatcgggatcct
ctttgttttgagtatattaccaagactacttttcctcaatttgtgttccatcaaagtggg
aaggccactggttgtgattgcgtggacggttgcgctcatgactgcttttgctttatgaaa
aatggaagtgagtttccatataatcaacatgggcgtctcgtccgagggaagcctttgatt
tttgaatgtggaccattttgccgttgtcctcctcattgccgcaatcgtgttacacaaaag
gggccaaagaataggttggaagtgtttaggtctacacagacaggttggggagttaggtcc
ttggaccttattcatgctggtgcttttatctgtgagtatgcaggggttattttgactagg
gagcaagcacaaattttgacaatgaatggttgcgattcatcgatacatcctaatcaattt
tctaagagatgggccgaatggggggatatatctcagatatactctgattatgtccgtcca
tcacatccatcagttcctcctttagatttttctcttgatgtgtcaacaatgaggaatatt
gcttgctatatgagccatagttcaaccccaaatgtgtttgttcagtttgttctgtatgat
cataacaatttgatgttccctcacattatgatatttgcgttggagaacatccctccgatg
agagagctcagccttgattacggggtagcggacgagtgtacaggcaagctctccatatgt
aactga

DBGET integrated database retrieval system