KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109339648Help
Entry
109339648         CDS       T04664                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lang00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    109339648
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109339648
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109339648
   00430 Taurine and hypotaurine metabolism
    109339648
Enzymes [BR:lang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109339648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
LG02
AA seq 507 aa AA seqDB search
MVLSKTAPETDVSIHSTFASRYVRVSLPRFRMPEQSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMAAINKNYVDMDEYPVTTELQNRCVNIIAHLFNAPLEETEHAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKEEGKPYDNPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYILDPEKAIEMVDENTICVAAILGSTLNGEFEDVKRLNDLLSEKNTETGWNTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKLVMENCRDNMIVLKEGLEK
TDRFDIVSKDDGVPLVAFTLKDNSHFDEFQVSDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRALAERLVVDIQKVLHELEMLPSKLLTKTAITVAGDEGLNDDAKVVVVKKSALE
TQREITTAWKKFVMDRKKMNDKMNGVC
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggtcctctccaaaactgcacccgagacagacgtctccatccactcaacatttgcctca
cgctatgtccgcgtttcccttcccaggttcaggatgccggagcagtcaatccccaaggaa
gctgcataccagatcataaatgatgaactcatgttggatggtaacccaaggcttaaccta
gcttcttttgttacaacctggatggagccagaatgtgataagctcatgatggctgccatt
aacaagaactacgttgacatggatgagtatcctgttaccactgagcttcagaatcggtgt
gttaacataatagctcatcttttcaatgcaccactagaagagactgaacatgcagttggt
gttggcactgttgggtcatctgaggctattatgttggctggattggcatttaaaaggaag
tggcagaataaaaggaaagaagaaggcaaaccctatgacaatcctaacattgttactggt
gccaatgttcaggtttgctgggagaaatttgcaaggtactttgaggtggagttgaaagag
gtcaagctgcgagaaggatactatatattggaccctgaaaaggccattgaaatggtggat
gagaacaccatttgtgttgctgccatccttggttccacactaaatggagagtttgaagat
gtcaaacgcttaaacgatctcctatctgaaaagaatacggaaactggatggaacacccca
attcatgtggatgcagccagtggtggattcattgcaccatttctttatccagaacttgag
tgggactttagattaccactagtgaagagcatcaatgttagtggacacaaatatggtctt
gtctatgctggaattggttgggtcatttggagaaacaaagaagaccttccagaggaactt
attttccacattaactatcttggagctgatcaacccactttcaccctcaacttctccaaa
ggttctagccaagttattgctcagtactaccaactaattcgtcttgggtatgaggggtat
aaacttgtaatggaaaactgcagagacaacatgatagtacttaaagagggactcgagaaa
acagatagatttgacattgtatccaaagatgatggtgtaccattggtggccttcactttg
aaggacaacagccactttgatgaattccaagtctctgatatgctgaggcgctttggttgg
atagtgccagcatacacaatgcccccagatgcacaacatgtaaccgtgcttcgcgttgtc
attagggaggacttttcgcgtgcccttgccgagcgcctagttgttgatatccagaaagtg
ttgcatgagctggaaatgcttccttcaaagctgctcactaagacagccataacggttgct
ggagatgaaggtttaaatgatgatgccaaagtggtggttgttaagaagagtgctctggag
acccagagagaaatcactacagcttggaagaaatttgttatggataggaagaaaatgaat
gacaagatgaatggtgtctgctag

DBGET integrated database retrieval system