KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109345785Help
Entry
109345785         CDS       T04664                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:lang00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    109345785
Enzymes [BR:lang01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109345785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
LG04
AA seq 152 aa AA seqDB search
MAKGVAVLGSSEGVAGTVYFIQEGDGPTTVTGTLSGLKPGLHGFHVHALGDTTNGCLSTG
PHYNPNGKEHGAPEDDNRHAGDLGNINVGDDGTVTFSITDSQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKATGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagggtgttgcagttctcggaagcagtgagggtgttgctggaactgtttacttt
attcaggaaggagatggtccaaccactgtaactggtactctttctggtcttaagcctggc
ctccatggattccatgtccatgctcttggtgacaccacaaatggatgcctatcaaccgga
ccacactacaatcctaatggcaaggaacatggtgcccctgaggatgacaatcgtcatgct
ggtgatcttggaaatattaacgtcggtgatgatggtactgtgaccttctctattactgac
agtcagatccctctaactggaccaaactccatcatcggaagggctgttgttgtccatgct
gatcctgatgatcttgggaaaggtggtcatgagcttagcaaagccaccggaaacgctggt
ggcagagttgcttgtggcattattggtttgcagggataa

DBGET integrated database retrieval system