KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109348585Help
Entry
109348585         CDS       T04664                                 

Definition
(RefSeq) hexokinase-3-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lang00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109348585
   00051 Fructose and mannose metabolism
    109348585
   00052 Galactose metabolism
    109348585
   00500 Starch and sucrose metabolism
    109348585
   00520 Amino sugar and nucleotide sugar metabolism
    109348585
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109348585
Enzymes [BR:lang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109348585
Membrane trafficking [BR:lang04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109348585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
LG06
AA seq 501 aa AA seqDB search
MGRTVVVGVTVSLAVAACAVAALVVGERVRGRKKWKKVVNVLRELEEGCETRVERLKQVV
DAMAVEMHAGLASEGGSKLKMLLTFVDNLPNGTERGTYYALHLGGTNFRVLRVHLDGQRS
SISEHEVEHEVERQPVPQHLMTSTTEDLFDFIASSLKEFIAKEGDGSKLDRRELGFTFSF
PVKQMSVSSGILIKWTKGFSIVNMVGRDVAACLQDAVTRKGLDVRVAALVNDTVGTLALG
HYHDADTVAAIIIGTGTNACYLERIDSIIKCQGLLTASGHMVVNMEWGNFWSSHLPRTVY
DIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILRMSLESDLFGPISPKLSAPFILRTPL
MAVMHEDDSPDLREVARILNDIFEIKDVPLKARKVVVKVCDVVTRRAARLAAAGIVGILK
KIGRDGSGGITGGRSRSDMKMKRTVVAIEGGLYSSYTMFKEYLHEALEEILGEDIAKHVI
LKVTEDGSGIGTALLAASYSS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggggagaacggtggtggtgggagtgacggtgagtttagcggtggcggcgtgtgcggtg
gcggcgttggtggtcggagagagagtgagagggaggaagaagtggaagaaggtggtgaat
gtgctgagggaattggaagaagggtgtgaaactagggttgagagattgaagcaagtggtt
gatgctatggcggttgagatgcacgctggtttagcatctgaaggtggttctaagctcaaa
atgcttctcactttcgttgataatctcccaaatggaactgagagaggaacatactatgca
ctacatcttggcggtacaaattttagggtcttgcgggttcatttagatggtcaacgatct
tctatctcagaacatgaagtggaacatgaagtagaacgacaacccgtcccccaacattta
atgaccagcacaaccgaggatctctttgattttattgcatcttcattaaaggaatttatt
gcgaaggaaggagatggttccaagctagacagaagggaacttggatttacattctctttt
cctgtcaaacaaatgtcagtttcgtcaggcattttaatcaaatggacaaaagggttttcc
attgtaaatatggtaggaagagatgttgctgcatgcttgcaggatgccgtgactcgaaaa
ggccttgatgtacgggtggctgccttggttaacgacactgttggaacattagctcttggt
cattatcacgatgcagataccgttgctgcaattattattggcacaggcacaaatgcctgt
tatttggaacgaatagattctattatcaagtgtcaaggtcttcttacagcatctggtcac
atggttgtcaatatggaatggggaaacttttggtcatctcacttaccgagaacagtgtat
gacattgatttagatgctgagagccctaatccaaatgatcagggttttgagaaaatgata
tcaggaatgtatcttggtgatatcgtgaggagagtcattctccggatgtcattagaatcg
gatttgtttggacctatttctccaaagctttcagcgcctttcatactgaggactcctttg
atggctgtcatgcatgaggatgattcacctgatcttagagaagtagcgagaatccttaac
gacatatttgagattaaggatgttcctttgaaggcaagaaaagttgtggtgaaggtgtgc
gacgtggtgacacgtagagctgcacgattagcagcggctggtatagttggtatcttgaag
aagataggcagggatgggagtggtggcataacagggggaaggagtagaagtgatatgaaa
atgaagagaacagtagttgcaatagaagggggattatattctagctatacaatgtttaag
gaatatttgcatgaagctttggaagaaatattgggagaagatattgcaaagcatgttatt
ctaaaggtcactgaagatggatcaggcattggaacagcacttcttgctgcttcatattca
tcataa

DBGET integrated database retrieval system