KEGG   Lentibacillus amyloliquefaciens: AOX59_06815Help
Entry
AOX59_06815       CDS       T04204                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lao  Lentibacillus amyloliquefaciens
Pathway
lao00010  Glycolysis / Gluconeogenesis
lao00030  Pentose phosphate pathway
lao00051  Fructose and mannose metabolism
lao00052  Galactose metabolism
lao00680  Methane metabolism
lao01100  Metabolic pathways
lao01110  Biosynthesis of secondary metabolites
lao01120  Microbial metabolism in diverse environments
lao01130  Biosynthesis of antibiotics
lao01200  Carbon metabolism
lao01230  Biosynthesis of amino acids
lao03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:lao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOX59_06815
   00030 Pentose phosphate pathway
    AOX59_06815
   00051 Fructose and mannose metabolism
    AOX59_06815
   00052 Galactose metabolism
    AOX59_06815
  Energy metabolism
   00680 Methane metabolism
    AOX59_06815
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AOX59_06815
Enzymes [BR:lao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AOX59_06815
Protein phosphatases and associated proteins [BR:lao01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AOX59_06815
Messenger RNA biogenesis [BR:lao03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AOX59_06815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1 DUF2675
Motif
Other DBs
NCBI-ProteinID: ALX48345
UniProt: A0A0U4ECR7
LinkDB All DBs
Position
complement(1349559..1350518)
Genome map
AA seq 319 aa AA seqDB search
MKKIGVLTSGGDAPGMNAAIRAVVRKAIFNNIEVYGIKNGFQGLIEGNIEKMDIGSVGDI
IQRGGTILHSARCKEFKTDEGQNKGIEQMKKHGIEGLIVIGGDGSFRGAVKLTEKGYPCI
GIPGTIDNDIAGTDFTIGFDTALNTVIEAIDKVRDTASSHERTFIIEVMGRNAGDLALWA
GLADGAESILIPEKKDELHDVVERLKRGQERGKKHSIIVLAEGVDNGFNYAEKIKETADL
ETRVTVLGHLQRGGSPTASDRVLASRLGAEAVDLLLDGKAGKIAGIQNNQLVNHDISEIL
QKKHTIDLNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattggtgttttgaccagcggcggtgatgcacccggcatgaacgccgctata
cgtgcagtggtacggaaagcgatttttaataatatcgaagtatacggcataaaaaatggc
ttccagggcctgatagaaggcaatattgaaaaaatggatatcgggtctgtcggggatatt
attcaacgcggcggtacgatattacattctgccagatgcaaagagttcaaaacagacgag
ggccagaataaaggtatcgagcagatgaaaaaacatggaattgaaggattaatcgttatt
ggcggtgatggaagttttcgcggggcggtaaagcttacggaaaaaggatatccttgcatc
ggtataccgggcacgatcgataacgacattgcggggacggactttacaatcgggtttgat
accgcgttgaatacggtcattgaagcgattgacaaagttcgtgataccgcctcatctcat
gaaaggacatttattattgaagtaatgggccggaatgcaggtgatttggctttatgggcc
ggtcttgccgatggcgcagaaagcattctgatacctgagaaaaaagacgaactccatgac
gttgtcgaaaggttgaagcggggacaggaacgtggaaaaaaacacagtattattgtctta
gctgagggtgtggacaacggatttaattatgctgaaaaaataaaagaaacagctgattta
gagacccgtgtaacagtgctcggccatctccagcgcggtgggtctccaactgcatccgac
cgtgtgctcgccagccggctcggagcagaggctgtcgacttactgcttgatggaaaggca
gggaaaatcgctggtatccaaaataatcaattagtcaatcatgatatctctgagattttg
cagaaaaaacatacgattgatttaaatatgtaccaattgtccaaagaactttcgatttga

DBGET integrated database retrieval system