KEGG   Lentibacillus amyloliquefaciens: AOX59_06815Help
Entry
AOX59_06815       CDS       T04204                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lao  Lentibacillus amyloliquefaciens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:lao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOX59_06815
   00030 Pentose phosphate pathway
    AOX59_06815
   00051 Fructose and mannose metabolism
    AOX59_06815
   00052 Galactose metabolism
    AOX59_06815
  Energy metabolism
   00680 Methane metabolism
    AOX59_06815
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AOX59_06815
Enzymes [BR:lao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AOX59_06815
Protein phosphatases and associated proteins [BR:lao01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AOX59_06815
Messenger RNA biogenesis [BR:lao03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AOX59_06815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1349559..1350518)
Genome map
AA seq 319 aa AA seqDB search
MKKIGVLTSGGDAPGMNAAIRAVVRKAIFNNIEVYGIKNGFQGLIEGNIEKMDIGSVGDI
IQRGGTILHSARCKEFKTDEGQNKGIEQMKKHGIEGLIVIGGDGSFRGAVKLTEKGYPCI
GIPGTIDNDIAGTDFTIGFDTALNTVIEAIDKVRDTASSHERTFIIEVMGRNAGDLALWA
GLADGAESILIPEKKDELHDVVERLKRGQERGKKHSIIVLAEGVDNGFNYAEKIKETADL
ETRVTVLGHLQRGGSPTASDRVLASRLGAEAVDLLLDGKAGKIAGIQNNQLVNHDISEIL
QKKHTIDLNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattggtgttttgaccagcggcggtgatgcacccggcatgaacgccgctata
cgtgcagtggtacggaaagcgatttttaataatatcgaagtatacggcataaaaaatggc
ttccagggcctgatagaaggcaatattgaaaaaatggatatcgggtctgtcggggatatt
attcaacgcggcggtacgatattacattctgccagatgcaaagagttcaaaacagacgag
ggccagaataaaggtatcgagcagatgaaaaaacatggaattgaaggattaatcgttatt
ggcggtgatggaagttttcgcggggcggtaaagcttacggaaaaaggatatccttgcatc
ggtataccgggcacgatcgataacgacattgcggggacggactttacaatcgggtttgat
accgcgttgaatacggtcattgaagcgattgacaaagttcgtgataccgcctcatctcat
gaaaggacatttattattgaagtaatgggccggaatgcaggtgatttggctttatgggcc
ggtcttgccgatggcgcagaaagcattctgatacctgagaaaaaagacgaactccatgac
gttgtcgaaaggttgaagcggggacaggaacgtggaaaaaaacacagtattattgtctta
gctgagggtgtggacaacggatttaattatgctgaaaaaataaaagaaacagctgattta
gagacccgtgtaacagtgctcggccatctccagcgcggtgggtctccaactgcatccgac
cgtgtgctcgccagccggctcggagcagaggctgtcgacttactgcttgatggaaaggca
gggaaaatcgctggtatccaaaataatcaattagtcaatcatgatatctctgagattttg
cagaaaaaacatacgattgatttaaatatgtaccaattgtccaaagaactttcgatttga

DBGET integrated database retrieval system